KEGG   Sordaria macrospora: SMAC_03915Help
Entry
SMAC_03915        CDS       T01610                                 

Definition
(RefSeq) putative cytoplasmic manganese antioxidant oxidoreductase
  KO
K04564  superoxide dismutase, Fe-Mn family [EC:1.15.1.1]
Organism
smp  Sordaria macrospora
Pathway
smp04146  Peroxisome
Brite
KEGG Orthology (KO) [BR:smp00001]
 09140 Cellular Processes
  09141 Transport and catabolism
   04146 Peroxisome
    SMAC_03915
Enzymes [BR:smp01000]
 1. Oxidoreductases
  1.15  Acting on superoxide as acceptor
   1.15.1  Acting on superoxide as acceptor (only sub-subclass identified to date)
    1.15.1.1  superoxide dismutase
     SMAC_03915
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Sod_Fe_C Sod_Fe_N
Motif
Other DBs
NCBI-GeneID: 10805524
NCBI-ProteinID: XP_003348069
LinkDB All DBs
Position
Unknown
AA seq 227 aa AA seqDB search
MTGNATTMSGLATYTLPQLPYAYNALEPYISAQIMELHHSKHHQTYVTNLNNALQAHVAA
ITSNDIPAQIAQQPAIKFNGGGHINHSLFWKNLAPADTPETNHSEAAPLLVAEIEKTFGS
FDGFKKAFSAALLGIQGSGWGWLVKESTSENSSRLRIVTTKDQDPVVGSGEVPVFGVDMW
EHAYYLQYLNGKAAYVENIWKVINWKTVEGRFQGSREDAFAALKALL
NT seq 684 nt NT seq  +upstreamnt  +downstreamnt
atgacaggaaacgcaaccaccatgtctggcctcgcgacttatacgctgccacagctgccg
tatgcctacaatgctctggagccctacatctcggcccagatcatggagcttcaccacagc
aagcaccaccagacctacgtgaccaacctcaacaacgccctgcaagcccacgtcgccgcc
atcacctccaacgacatccccgcccagatcgcccagcagcccgctatcaagttcaacggc
ggcggccacatcaaccactcgctcttctggaagaacctggcccccgccgatacaccagag
accaaccactcggaggcggcccctttgctggtggccgagattgaaaagacattcggcagc
tttgacggcttcaaaaaggccttctctgctgcgctcttgggcatccagggtagtggctgg
ggctggctcgtcaaggagtctacttccgagaacagcagcaggctgcgcatcgtcaccacc
aaggatcaggatcccgtcgtgggcagcggtgaggtgcccgttttcggggtggacatgtgg
gagcatgcgtactaccttcagtacctgaacggaaaggccgcgtatgttgagaatatctgg
aaggtgatcaactggaagacggttgaggggcgattccagggtagtcgtgaggacgccttt
gcagccctcaaggctctgctatga

DBGET integrated database retrieval system