KEGG   Sordaria macrospora: SMAC_05035Help
Entry
SMAC_05035        CDS       T01610                                 

Gene name
putative sod1
Definition
(RefSeq) putative SOD-1 superoxide dismutase (Cu-Zn)
  KO
K04565  superoxide dismutase, Cu-Zn family [EC:1.15.1.1]
Organism
smp  Sordaria macrospora
Pathway
smp04146  Peroxisome
Brite
KEGG Orthology (KO) [BR:smp00001]
 09140 Cellular Processes
  09141 Transport and catabolism
   04146 Peroxisome
    SMAC_05035 (putative sod1)
Enzymes [BR:smp01000]
 1. Oxidoreductases
  1.15  Acting on superoxide as acceptor
   1.15.1  Acting on superoxide as acceptor (only sub-subclass identified to date)
    1.15.1.1  superoxide dismutase
     SMAC_05035 (putative sod1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Sod_Cu Tox-HNH-EHHH
Motif
Other DBs
NCBI-GeneID: 10810573
NCBI-ProteinID: XP_003352921
UniProt: F7VUT1
LinkDB All DBs
Position
Unknown
AA seq 154 aa AA seqDB search
MVKAVAVLRGDSNVKGTVIFEQESESAPTTITYDISGNDPNAKRGFHIHTFGDNTNGCTS
AGPHFNPRGTTHGNRTDEVRHVGDLGNLETDAQGNAKGSVTDNLVKLIGPESVIGRTVVV
HAGTDDLGKGGNEESLKTGNAGPRPACGVIGISQ
NT seq 465 nt NT seq  +upstreamnt  +downstreamnt
atggtcaaggctgtcgctgttctccgtggtgactctaacgtcaagggcaccgtgatcttc
gagcaggagtccgagtccgctcccaccaccatcacctacgacatctccggcaacgacccc
aacgccaagcgtggcttccacatccacaccttcggtgacaacaccaacggctgcacctct
gccggccctcacttcaacccccgtggcaccacccacggcaaccgcaccgacgaggtccgc
cacgtcggtgatctcggcaacctcgagaccgatgctcagggtaacgccaagggctccgtg
actgacaacctcgtcaagctcatcggccccgagtccgtcattggccgcaccgtcgtcgtc
cacgccggcactgacgaccttggcaagggtggcaacgaggagtccctcaagactggcaac
gccggtccccgccccgcctgcggcgtcattggtatctcccagtaa

DBGET integrated database retrieval system