KEGG   Sordaria macrospora: SMAC_06054Help
Entry
SMAC_06054        CDS       T01610                                 

Definition
(RefSeq) uncharacterized protein
  KO
K10747  DNA ligase 1 [EC:6.5.1.1 6.5.1.6 6.5.1.7]
Organism
smp  Sordaria macrospora
Pathway
smp03030  DNA replication
smp03410  Base excision repair
smp03420  Nucleotide excision repair
smp03430  Mismatch repair
Brite
KEGG Orthology (KO) [BR:smp00001]
 09120 Genetic Information Processing
  09124 Replication and repair
   03030 DNA replication
    SMAC_06054
   03410 Base excision repair
    SMAC_06054
   03420 Nucleotide excision repair
    SMAC_06054
   03430 Mismatch repair
    SMAC_06054
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03032 DNA replication proteins [BR:smp03032]
    SMAC_06054
   03400 DNA repair and recombination proteins [BR:smp03400]
    SMAC_06054
Enzymes [BR:smp01000]
 6. Ligases
  6.5  Forming phosphoric-ester bonds
   6.5.1  Ligases that form phosphoric-ester bonds (only sub-subclass identified to date)
    6.5.1.1  DNA ligase (ATP)
     SMAC_06054
    6.5.1.6  DNA ligase (ATP or NAD+)
     SMAC_06054
    6.5.1.7  DNA ligase (ATP, ADP or GTP)
     SMAC_06054
DNA replication proteins [BR:smp03032]
 Eukaryotic Type
  DNA Replication Elongation Factors
   Other elongation factors
    SMAC_06054
 Prokaryotic Type
   Elongation factors (archaeal)
    Other elongation factors
     SMAC_06054
DNA repair and recombination proteins [BR:smp03400]
 Eukaryotic Type
  SSBR (single strand breaks repair)
   BER (base exicision repair)
    Long Patch-BER factors
     SMAC_06054
   NER (nucleotide excision repair)
    Other NER factors
     SMAC_06054
   MMR (mismatch excision repair)
    Other MMR factors
     SMAC_06054
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: DNA_ligase_A_M DNA_ligase_A_N DNA_ligase_A_C RNA_ligase
Motif
Other DBs
NCBI-GeneID: 10806848
NCBI-ProteinID: XP_003349359
UniProt: F7W5X4
LinkDB All DBs
Position
Unknown
AA seq 918 aa AA seqDB search
MSSPAKTRKLNSGAKQPSSVPSRGLEYFFAKQKQNGASKEPSTSAKGSNSDATQRGPSEE
QLTDEELARKLQAEWDAEAKLSSTPRETSVRPQDVPVPATGSVETVTVEPTKEAKPHTLT
SPPKANQLKGKNTLSLSSAAATEDQTSASIPLDKSPLTFDPTKYIPQLQESWANDGGDAS
YALLTRCFLLVSSTSSRIKIVDTLVNCIRLLIEGDPSSLLPAVWLATNAISPPYVSMELG
LGGSAISKALKQVCGLDNRSLKTLYDKLGDPGDVAFEAKKKQSFTLRKPKPLTIKGVFRS
LVKISKTQGQGSGDVKQRIVDKLLQDARGGEESRYVVRTLCQHLRIGAVKTTMLIALARA
FLLSKPPGTDFPTKDPSQLAKLKKEELAEVYLKAEEIVKASFARHPDYNDLVPVLLEIGV
CEELLVRCGLTLHIPLRPMLGGITRDLSEMLTRLRGRDFACEYKYDGQRAQIHCDEKGVV
SIFSRHLELMTDKYPDLVTLVPKIRGEDVQSFIMEGEVVAVDRATGELKNFQTLTNRARK
DVAIGSITIDVCLFAFDLMYLNGQPLLNRSFRERRDMLRSLFVEIPHHFTWVKSIDATSQ
DSETVLEFFKSAVDSKCEGIMVKILDNLSELEAPIPDDSANSEALEEQQLPISTNATPAP
ASSKKPPKGKSKPKPKTTETTASSDTPPIPEKKPQSSRRKPLLATYEPDKRLDSWLKVKK
DYIGTSAGFSDTLDLLPIAAWHGSGRKAKWWSPILLAVRNEETGSLEAVCKCMSGFTDAF
YKANREFYDKDGSFSPDNEPNNVHATKPGFVEYAGGNPDVWFEPQEVWEVAFADITISPT
YTAAIGLVREDKGLSLRFPRFLRKREDKGIEEASTSEFLAGLWRKQEAKAPAPLLVEGGG
EDGEAGWDNEDEEEEDGE
NT seq 2757 nt NT seq  +upstreamnt  +downstreamnt
atgtccagtccagccaagacacgcaaactcaactctggcgcaaagcaaccatcttcggtg
cccagcagaggtctcgaatacttctttgctaaacaaaagcagaacggtgcttcgaaggaa
ccatctacttcagcaaaggggtctaactctgatgctactcagcgagggccgtcagaagaa
caattgaccgatgaggagcttgcacgaaagctgcaggccgaatgggatgccgaggcaaag
ctctcgtcaacaccgagggaaactagtgtccgcccgcaggatgtgccagtgccagcaaca
gggtccgtggaaacagtcacagttgaaccaaccaaggaggcaaaaccgcacacattaacc
tcaccgcccaaggctaaccagctgaaaggaaagaatacattgtcactctcttccgcagcc
gctacagaggaccagacatcagcatctatccctcttgacaagagtccgctgaccttcgac
ccaaccaagtacattccccaacttcaggaatcatgggccaatgatggaggagatgcgtcc
tatgccctcctcacacgatgctttctcttggttagcagcacctcaagcaggatcaaaatc
gtcgacactctggttaactgcatccgattattgatcgagggagatccctcgagtttgttg
cccgcagtatggctcgcaacgaacgccatttccccgccgtatgtttctatggaacttggt
cttggcggttctgctatttcaaaggctctcaaacaagtgtgtggcctcgacaacaggtcg
ctaaagacactctatgataaactgggtgacccgggcgatgttgcatttgaggcaaagaag
aaacagagctttactctacgaaagccaaaaccgctaacaatcaagggggtcttccggtca
ctggtcaaaatttcaaagactcagggtcagggcagtggcgatgtaaagcaacggattgtt
gacaagttgctccaagatgctcgcggaggtgaagaaagcagatatgtcgttaggacacta
tgtcaacatttgcgcatcggagctgtcaaaaccaccatgcttatcgccctggctcgagcc
tttctgctctcgaaacctccaggcacggacttcccaacaaaagacccaagtcaactggcg
aagctgaagaaagaggagcttgccgaagtctatctgaaggccgaagagatagtcaaggct
tcatttgcccgacacccagattacaacgaccttgtaccagtactgctcgagattggtgtg
tgtgaggagttattggtgcgatgcggtctaacacttcacattcccctgcggcccatgctt
ggtggcatcaccagagacttgtcagagatgctcactcgacttcgagggcgggacttcgca
tgcgagtacaagtatgacggccagcgtgcccagattcactgcgacgagaagggtgttgtc
tccatattctctcgccatctcgaactcatgacagacaagtaccccgacctggtcacgctc
gttcccaaaatcaggggcgaagatgtccagagcttcatcatggagggcgaagtggtcgcc
gtggaccgggccaccggcgagctgaagaacttccagacattgacgaaccgtgccaggaaa
gacgtggcaataggcagcatcaccatcgacgtgtgtctgttcgcctttgacctcatgtat
cttaacggacaaccgctcctcaacagatcattccgagaacgccgcgacatgttacgttca
ctctttgtagagataccgcatcacttcacctgggtcaaaagcatcgatgcgacgtctcag
gactcagaaaccgttctcgagttctttaagtcagccgtcgacagcaagtgtgaaggtatc
atggtcaagattctcgacaacctgtccgaactggaagctcccatacccgacgactctgcc
aactcagaagccctcgaagagcagcagctccctatctccaccaatgccaccccagcccca
gcctcttccaaaaagccacccaagggaaaatccaaacccaaacccaaaaccaccgagacc
acagcatcctccgacacgccccccattcctgaaaagaaaccacaatcctcccgacgcaaa
cccctcctagcgacctacgagcccgacaagcgtctcgactcctggctcaaagtaaaaaaa
gactacatcggcacctccgccggcttttcagacacgctcgacctgctccccatcgccgcc
tggcacggttccggccgcaaagccaaatggtggtcccccatccttctggccgtgcgcaac
gaagagacgggatcgctggaagcagtatgcaagtgcatgagcgggttcaccgacgccttc
tataaggccaaccgggagttttacgataaagacggctcgttcagtcccgataacgagccg
aacaatgttcatgcgacgaaaccggggttcgtcgagtatgccggcggaaatccggatgtg
tggtttgagccgcaggaggtgtgggaggtggcgtttgcggacatcacgattagtccgacg
tatacggcggcgattgggctggtgagggaggataaggggctgagtttgaggtttccgcgc
ttcttgaggaagagagaggataaagggattgaggaggcgagtacgagtgagtttttggcg
gggttgtggaggaagcaggaggcgaaggcacccgcgccgctgctggttgagggtggagga
gaagatggtgaagcgggttgggacaatgaggatgaggaggaagaggatggagaatag

DBGET integrated database retrieval system