KEGG   Sordaria macrospora: SMAC_06408Help
Entry
SMAC_06408        CDS       T01610                                 

Definition
(RefSeq) uncharacterized protein
  KO
K01580  glutamate decarboxylase [EC:4.1.1.15]
Organism
smp  Sordaria macrospora
Pathway
smp00250  Alanine, aspartate and glutamate metabolism
smp00410  beta-Alanine metabolism
smp00430  Taurine and hypotaurine metabolism
smp00650  Butanoate metabolism
smp01100  Metabolic pathways
smp01110  Biosynthesis of secondary metabolites
Module
smp_M00027  GABA (gamma-Aminobutyrate) shunt
Brite
KEGG Orthology (KO) [BR:smp00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00650 Butanoate metabolism
    SMAC_06408
  09105 Amino acid metabolism
   00250 Alanine, aspartate and glutamate metabolism
    SMAC_06408
  09106 Metabolism of other amino acids
   00410 beta-Alanine metabolism
    SMAC_06408
   00430 Taurine and hypotaurine metabolism
    SMAC_06408
Enzymes [BR:smp01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.1  Carboxy-lyases
    4.1.1.15  glutamate decarboxylase
     SMAC_06408
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Pyridoxal_deC Beta_elim_lyase Aminotran_5 SepSecS
Motif
Other DBs
NCBI-GeneID: 10802102
NCBI-ProteinID: XP_003344753
UniProt: F7W6Q0
LinkDB All DBs
Position
Unknown
AA seq 546 aa AA seqDB search
MNGTHSTDKSALNRAGEVDRLIDAVKSLIVPFIRDADNAASFRATGQLPPDNRNVLVESL
RPEQLVKQLALSLPQGEGAGQDGLLQTIQSILSHSVNTWDQGFMDKLYASTNAVGVVTEL
LLSVLNTNLHVYQVSPALTVIEKHTAKQFASLFGFTGPRAGGVTCQGGSASNLTSIVVAR
NTLFPLSKLHGNNHTECGAPGPLILLTSAHGHYSVEKAAVTCGFGSSSVWTVPVDAQGRM
CPSALRETVLRAKQEGKHPFYVNATAGTTVMGSYDPLDEIADLCDEFGMWMHIDGSWGGP
AIFSEKHRHKMQGSHRARSLTVNPHKMLNVPVTCSFLLTDDVKVFHKANTLPAGYLFHGP
AAAAGDDEGIDEEKKTTAEEEVLINGNGCGNGNGPKEVWDLADLTLQCGRRGDALKLALS
WIYYGAAGFERQIDGAFEMAAYLADLISQRKDFVLVSSNPPPCLQVCFYYAPGGKLAEDP
EENTRRTSKMVEKLIARGFMVDYAPGERGSFFRVVVNCQTLRGTVEGLVKGLEAVGREVV
VVPPAI
NT seq 1641 nt NT seq  +upstreamnt  +downstreamnt
atgaacggaactcacagtacggacaagtctgctctaaacagggcaggcgaggttgatcgt
ctcattgatgcggtcaagtccctaatcgtccccttcatccgggacgcagacaacgccgcc
tccttccgagccaccggccagctgcccccagacaaccgcaatgtcctcgtcgaatccctc
cgcccagagcagctcgtgaagcagctcgccctatccctcccgcaaggtgagggcgcaggt
caggatggtctgctccaaaccatccagtccatcctctctcactccgtcaacacctgggac
cagggtttcatggacaagctctacgcctccaccaacgccgtcggcgtcgtcaccgagctc
ctcctctccgtcctcaacaccaacctgcacgtctaccaagtctctcccgccttgacggtc
atcgagaagcacacagccaagcagttcgcttccctgtttggcttcaccggcccgcgcgcc
ggcggcgtcacctgccagggtggcagcgcttcaaacctgacctccatcgtcgttgcccgc
aacacgcttttccctctctccaaactccacggcaacaaccacaccgaatgcggcgccccg
ggccctctgatcctgctcaccagcgcgcacgggcactactcggtcgaaaaggccgcggta
acatgcggtttcggctcctcatccgtctggaccgtccccgtcgacgcgcaaggccgcatg
tgcccctccgccctccgggaaaccgtcctgcgcgccaagcaggagggcaaacacccgttt
tacgtcaacgccacggcgggcaccacggtcatgggctcgtacgacccccttgacgagatc
gcggacttgtgcgacgagttcggcatgtggatgcacattgacgggtcctggggcgggccg
gcgattttcagcgagaagcataggcataagatgcaggggtcgcacagggcaaggagcttg
acggttaatccgcacaagatgctcaatgtacctgttacgtgctcgttcctgttgacggat
gatgtcaaggtttttcataaggcgaatacgttgccggctgggtatctgtttcatggcccg
gccgcggcggcgggggatgacgagggtattgatgaggaaaagaagacgacagcagaagaa
gaggtgttgataaatggaaacgggtgtggaaacggcaacggcccaaaagaagtctgggac
ctggccgacctgacgctgcagtgcggccgcagaggcgacgcgctcaagctggcgctgtcg
tggatctactacggcgcagccgggttcgagcggcagatcgacggcgcctttgagatggct
gcgtacctggccgatctaatttcgcagcgcaaggactttgttttggtgtcgtcgaacccg
ccgccgtgcttgcaggtgtgcttttattatgcccctggcggcaagctggcggaggatcca
gaggagaacacgcggaggacgagtaaaatggtggagaaactgattgcgagaggcttcatg
gtggattacgcgccgggcgagaggggaagcttctttagggtggtggttaattgccagacg
ctgagggggacggtggagggcttggttaaggggttggaagctgttgggagggaggttgtt
gttgtcccgccagcgatttga

DBGET integrated database retrieval system