KEGG   Sordaria macrospora: SMAC_06646Help
Entry
SMAC_06646        CDS       T01610                                 

Definition
(RefSeq) uncharacterized protein
  KO
K00693  glycogen synthase [EC:2.4.1.11]
Organism
smp  Sordaria macrospora
Pathway
smp00500  Starch and sucrose metabolism
smp01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:smp00001]
 Metabolism
  Carbohydrate metabolism
   00500 Starch and sucrose metabolism
    SMAC_06646
Enzymes [BR:smp01000]
 2. Transferases
  2.4  Glycosyltransferases
   2.4.1  Hexosyltransferases
    2.4.1.11  glycogen(starch) synthase
     SMAC_06646
Glycosyltransferases [BR:smp01003]
 Polysaccharide
  Storage polysaccharide
   SMAC_06646
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Glycogen_syn Glyco_transf_4 Glyco_transf_5 Glycos_transf_1 Glyco_trans_1_4 Glyco_trans_4_4
Motif
Other DBs
NCBI-GeneID: 10803557
NCBI-ProteinID: XP_024511675
LinkDB All DBs
Position
Unknown
AA seq 707 aa AA seqDB search
MAHDNREPREVKNHLLFEVATEVAHRVGGIYSVIKSKAPVTTAEYGDRYTLIGPLNHQSA
AVEVEELEPTNPELKATIQAMRDRGIGILYGRWLIEGAPRVLLFDTKTAYGYLNEWKTDL
WNVASIPSPDNDEETNEAIVFGYLVAWFLGEFVCHEKKKAVIAHFHEWLAGVALPLTKRR
QIDVTTIFTTHATLLGRYLCAGSVDFYNNLQWFDVDAEAGKRGIYHRYCIERAAAHSCDV
FTTVSHITAYESEHLLKRKPDGVLPNGLNVTKFSAMHEFQNLHQQSKEKIHDFVRGHFYG
HYDFEPENTLYFFTAGRYEFRNKGVDMFIESLARLNHRLKTAGSKTTVVAFIIMPAQTTS
LTVEALKGQAVIKSLRDTVDVIERGIGRRIFERSLKWHEGDPLPDEKELITSQDRVLLRR
RLFAMKRHGLPPIVTHNMLNDHEDPILNQIRRVQLFNHPSDRVKIVFHPEFLSSANPVLP
LDYDDFVRGTHLGVFSSYYEPWGYTPAECTVMGVPSITTNLSGFGCYMEELIENSSDYGI
YIVDRRTKGVDDSVNQLTQYMFEFAQKSRRQRINQRNRTERLSDLLDWKRMGMEYVKARQ
LALRRAYPTSFNGDEEEDFIPGVEQKISRPFSVPGSPRDRTGMMTPGDFASLQESHEGLS
TEDYVAWKLPEEEDPEEYPFPLTLKQRTGPGSPLDGAIQGLQINGSK
NT seq 2124 nt NT seq  +upstreamnt  +downstreamnt
atggcccacgataaccgtgaaccccgcgaggtcaagaaccacctcctcttcgaggttgcg
accgaggtcgcccatcgagttggtggtatctactccgttatcaagtcgaaagcccccgtt
acaaccgctgaatatggcgaccgttatactcttatcggtcccctcaaccaccaatcggcg
gccgtcgaggttgaagaactggagcctaccaatcctgaactaaaggcgacgatccaggcc
atgagagatcgtggcattggcattctgtacggacgatggctcattgagggagctcctaga
gtgttgcttttcgatacaaagaccgcctacggttacttgaacgagtggaagacggacctc
tggaacgttgcttccatcccatccccggacaacgacgaagagacgaacgaggctattgtc
ttcggttacctggtcgcatggttccttggcgagttcgtgtgccacgagaagaagaaggct
gttattgcccacttccacgaatggcttgccggtgttgcgctgccattgaccaagaggagg
cagattgacgttacgactatcttcacgacacatgccactcttctcggtcgctacttgtgc
gcaggctctgtggacttctataacaaccttcagtggttcgatgttgatgctgaggctgga
aagcgcggtatctatcacagatactgcatcgagcgagctgccgcccattcttgcgatgtc
ttcaccaccgtttcccacatcaccgcctacgagagtgagcatttgctcaagcgcaagccc
gatggtgtcctccccaacggtctcaacgtcaccaagttctcggccatgcatgagttccag
aacctccatcagcagtccaaggaaaagatccacgactttgtccgcggtcacttttatggc
cattacgatttcgagccagaaaacaccctctacttcttcactgccggtcgctacgagttc
aggaataagggtgtggatatgttcattgagtcgcttgcccgtcttaaccaccgcctgaag
accgccggaagcaagaccacggttgttgctttcatcatcatgcctgcccagaccacttcc
ttgactgttgaagcattgaaggggcaggccgtcatcaagtctctgagagacaccgtcgat
gttatcgagcgtggcattggccgccgcatcttcgagcgctctctcaagtggcacgagggc
gacccgttgcctgatgagaaggagctgatcaccagccaggaccgtgtcctccttcgtcgt
cgtctcttcgccatgaagaggcatgggctcccgcccattgttacccacaacatgctcaac
gaccatgaagacccgattctgaaccagatccgccgggtacaactcttcaaccatccctcg
gaccgcgtcaagattgttttccatcccgagttcttgagctcggccaaccccgtgttgcct
cttgactacgatgactttgtgcgcggcacccatttgggtgtcttctcttcttactatgag
ccttggggttacactccggcagaatgcacggttatgggtgtaccaagcatcaccaccaac
ctttctggatttggctgctacatggaggagctcattgagaactcgagcgactacggtatc
tatatcgtggaccgtcgcaccaagggcgtcgatgactcagtcaaccagcttactcagtac
atgtttgagtttgcccagaagagccgcagacagcgtatcaaccagagaaacagaaccgag
cgtttgagcgatctcttggactggaagcgcatgggcatggagtacgtcaaggcccgccaa
ctcgcgttgcgccgcgcctatcccacgtctttcaatggcgacgaggaggaagacttcatc
ccaggagtcgagcagaagatttctcgtcccttctcagtgccgggctcacctagagaccgg
actggtatgatgacccctggcgatttcgctagtcttcaggaaagtcatgagggtttgagt
accgaggattacgttgcgtggaagctacctgaggaagaggaccccgaagagtaccctttc
ccgcttaccctcaagcagcgcacggggccgggtagccctctcgatggtgctatccaaggc
ctgcaaatcaacggcagcaagtaa

DBGET integrated database retrieval system