KEGG   Sordaria macrospora: SMAC_07369Help
Entry
SMAC_07369        CDS       T01610                                 

Definition
(RefSeq) uncharacterized protein
  KO
K11484  histone deacetylase HOS3 [EC:3.5.1.98]
Organism
smp  Sordaria macrospora
Brite
KEGG Orthology (KO) [BR:smp00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03036 Chromosome and associated proteins [BR:smp03036]
    SMAC_07369
Enzymes [BR:smp01000]
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.1  In linear amides
    3.5.1.98  histone deacetylase
     SMAC_07369
Chromosome and associated proteins [BR:smp03036]
 Eukaryotic Type
  Histone modification proteins
   HDACs (histone deacetylases)
    Class I HDACs
     SMAC_07369
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Hist_deacetyl
Motif
Other DBs
NCBI-GeneID: 10805447
NCBI-ProteinID: XP_003347994
UniProt: F7W8L5
LinkDB All DBs
Position
Unknown
AA seq 1250 aa AA seqDB search
MTMASSSSAAFHNRPSSSASVASSRSSTTNPRRASGVPAGAGSDAHATPPSVSTLQQRRL
SRTASKGQLNKNNAEGDLTQSLNHLSISLASPSSATSQSPSPRKSPRTANHPPPPAISPL
RPQFSSPTPSAVSPNGTTSRPGSAMRNVSYSGAPSRSQTPALRRKASMNSIQVAHNNHGQ
GPSLSRRSSSVNLTQSAAKKPPLNDMYPETSEFKVPPTPQSIASDHFKAELEIHHGEEPS
LPAETVVILNDACYGHRYSRPRTSKANLSTIVERPERIKASVLGVSAAYVRLGERHHDGS
FPIHPDQDPKKLPSVPFVIQKTTRRLPITSQTVTNVHGTKWMEELKTMCDTAEAKLATNG
KELIRPDMDRGPNAEEPAKFHEGDLYLCAESLEAMEGAMGGVCEAVDAVFRPEGPKRAFV
AIRPPGHHCSASYPSGFCWVNNVHVGIMHAILSHGLTHAAIIDFDLHHGDGSQQIAWQHN
SRGVKATKNAAAWKKTSIGYFSLHDINSYPCETGDDEKVMNASICIDNAHGQNVWNVHLQ
PWKTEDEFWALYETKYTTLLEKARSYLVTQAERLRAAGQNAKAAIFLSAGFDASEWEGSG
MQRHKVNVPTEFYARLTRDVVRIAAEVGTAVEGRVISVLEGGYSDRALCSGIMSHVCGLA
GASATGNGQVHDQYKASWWSAAELERLETTLMTPPPEPPKPPRNVTPPTYCSPTHASTAR
SVAPRRSMSGLHQHALMAANRPLSPIPSRIPTTPAPEVSWAIAACELSKLLIPSDRQTDS
CTHTDLNAEATKARRERQLTHANTSSSDAGTANASDRPSTRMTLRERKTKQAMPIKEEDT
DDDRAIAVSVGETGVPRGGARAARSRRLSAASTIVPDSVDSSPPSHRYSTMNAGDDGRPE
TSMSIRPESSMSVRPQGNALAVKKTRGPAKNKYALQAPKIQRKTSTSTIESARSSNASLV
SPTPASHSGETQPSNGSNGDGVDNLTGGMKKVKITLITQAQKEARERERAAKENFSTANN
DAISVVTSNLDENKPHHQQQPTQTPVAATLHSPTESNTNSSPAPSTQFYTPNSQGRNSVS
SSEDMDATEKYPELFAHHHQHHQVQEVDGDGDIDMEDLETPALTSTPMPGRTSFPLPTRP
FQPARNPTGHQENFIQYQPPTTITTTNSTATAKSAQTPTSPGTAAMNRKDVPVFTATSAI
PFSPQKTSTLEQLQQQQPAGSESPAPSTPASLPSVIFSGQKQDEETPERN
NT seq 3753 nt NT seq  +upstreamnt  +downstreamnt
atgacaatggcttcgtcctcctccgccgcgttccacaacaggccgtcgtcttctgcgtcc
gtggcatcctctcgatcttccaccactaatcccaggagagcttccggtgtgccagcaggt
gctggatcagatgcacatgcgactccaccctcagtatcaactttgcaacaaagacggtta
tcacgaacggcaagcaaagggcagcttaataagaataatgcagagggtgatttaacacaa
tccttgaatcacctctccatttctctggcgtccccgtcctccgcgacttcacaatctcct
tctcccagaaagagtcctcgtactgccaaccacccgccgccacctgccatcagtcccctg
cggccccagttttcgtctccgactccgagtgctgtatcgccaaacggaacgacatcccgc
cccggtagtgctatgcggaacgtatcctacagcggggctccgtctcgctcacaaacccca
gcactccgccgaaaagcctccatgaactcgatccaggtcgcccacaacaaccacggccaa
ggcccatcactctcacgtcgctcctcttctgtcaacctcacccagtcggccgcaaaaaag
ccacccctaaacgatatgtaccccgagacgtccgagttcaaagtaccgccgaccccgcag
tctatcgctagtgaccacttcaaggctgaacttgagatccatcacggggaagaaccgagc
ctgccggctgagacagtcgttattttgaacgacgcatgctatggacatcgctactctcgc
ccgcggacatccaaggcgaacttgagcacgattgtcgaacgacccgagagaatcaaagcc
agcgtcttgggagtgtcggctgcctatgtacgtctgggcgagaggcatcatgacggctct
ttcccgatccatccggaccaagatcctaagaaactgccatcggtaccatttgtaatacag
aagacgactcggcgactgcccatcacatctcagacagtaaccaacgtacatggtacgaaa
tggatggaggagctcaagaccatgtgcgataccgcggaagccaagttggcgacgaatggg
aaagaactcatacgcccggacatggatcgtggacccaatgcggaagaacctgcaaagttc
catgaaggcgacctctatctttgtgccgagtcactggaggctatggagggagcaatggga
ggcgtctgtgaagcagtcgatgcagtcttcaggcccgagggcccgaaaagggcttttgta
gccattcgaccgcctggtcatcactgttctgcatcatatccctccggcttttgctgggtc
aacaatgtccatgttggcattatgcatgcaattctgagccatggcttgacccatgccgcc
attatcgactttgacctccatcatggcgacggctcccagcaaatcgcttggcagcacaac
tcaaggggtgtaaaggctacaaagaacgcggcggcatggaagaagacatcgatcgggtac
ttcagtcttcacgatatcaactcgtatccgtgcgagaccggcgacgacgaaaaggttatg
aatgcaagcatttgtatcgacaatgcacatggccaaaacgtctggaatgttcacctacag
ccctggaagacagaagatgagttctgggcgctgtacgagaccaagtataccaccttgctt
gaaaaggcgcgcagctatctggtcacacaggcggaacgcttgcgagcagcaggccaaaac
gcaaaggcagccatctttctctctgctggtttcgatgccagcgaatgggagggttccgga
atgcagagacacaaggttaatgttccgacagagttctatgctcgattgactcgagatgta
gtacgtatagcagcagaagtgggcacagccgtagaaggccgagttatcagcgtgctggag
ggaggttatagtgatcgcgcactttgctctggcatcatgagccacgtttgcggccttgct
ggagccagtgctactggaaatggtcaggttcatgatcagtacaaagcttcatggtggtct
gctgccgagcttgaacgtctggagaccactttgatgactcctccgcctgaaccacccaag
ccccctaggaatgttacaccacctacctactgttcacctacacatgcctctacagcgcgg
tctgtagcgccacggagaagtatgtccggacttcatcagcacgcactcatggcagccaac
aggccattgtcaccaataccgtcgagaataccgacgacccctgctccagaagtctcttgg
gctatcgcagcctgtgaattgagcaagcttcttattccgagcgaccgccagacagacagc
tgtactcacacagatctcaatgccgaggccaccaaggctcgccgggagcgtcagttaacc
cacgcgaatacctcgtcttccgatgccggcactgcaaatgcttcggaccggccttctact
aggatgaccttgagggagcgtaaaaccaagcaagcaatgcctatcaaggaggaggatacc
gacgacgatcgggcaattgctgtgtccgtaggagaaaccggtgtgcctcgtggaggtgct
cgtgctgcacgtagtcgacgccttagtgctgcatcgaccatcgtcccagacagtgttgac
tcatctcctccaagccacagatactcaaccatgaatgcgggagacgacggaagaccggaa
acatccatgagcattaggcctgagtcttcaatgagcgttagaccgcaaggaaatgctctt
gcggtcaagaaaacgcggggaccagcaaagaacaagtatgctctgcaggcaccaaagata
cagaggaagacttcaacatcgaccatcgagtcagcaaggagctccaacgcatccttagta
tcaccaactccagcctctcactccggcgagactcagccatcgaacggcagcaatggcgac
ggcgtggataacttgactggcgggatgaagaaggttaagatcactcttatcacacaagcc
cagaaagaggctcgcgagcgggagcgcgccgcgaaagaaaacttttccaccgccaacaat
gatgcgatatccgtcgtaacctccaacctcgatgaaaacaaacctcaccaccaacaacag
cccacacagacacccgttgccgccacgctccactcgcccaccgaaagcaacaccaacagc
tcccccgcaccatccacccagttctacacccccaactcacaaggccggaattccgtctcc
tcctccgaagacatggacgccacggagaagtaccccgagctatttgcccaccaccaccag
caccatcaagtccaagaagtggacggagacggcgacatcgacatggaagacctcgaaaca
ccagccctcacttccacgcccatgccaggccgtacatccttccctttgccgacgcggcct
ttccagcctgctcgaaacccaacaggccatcaggagaatttcatccagtaccaaccaccc
actaccattaccactaccaactctactgctactgccaagtcagcgcaaacaccaactagt
cccggaactgctgctatgaacaggaaggacgttcctgtgttcacggccacttcagcaatt
cccttttcgcctcaaaagacttccactttggagcaattgcagcagcagcagcctgccggg
tctgagtctccggcgccgtctacgcctgcttcgttacctagtgtgattttctctggtcag
aagcaggatgaggagacgcccgagagaaattaa

DBGET integrated database retrieval system