KEGG   Sordaria macrospora: SMAC_08660Help
Entry
SMAC_08660        CDS       T01610                                 

Definition
(RefSeq) uncharacterized protein
  KO
K01187  alpha-glucosidase [EC:3.2.1.20]
Organism
smp  Sordaria macrospora
Pathway
smp00052  Galactose metabolism
smp00500  Starch and sucrose metabolism
smp01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:smp00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00052 Galactose metabolism
    SMAC_08660
   00500 Starch and sucrose metabolism
    SMAC_08660
Enzymes [BR:smp01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.20  alpha-glucosidase
     SMAC_08660
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Glyco_hydro_31 NtCtMGAM_N Gal_mutarotas_2 DUF5110
Motif
Other DBs
NCBI-GeneID: 10801755
NCBI-ProteinID: XP_003344465
UniProt: F7WAI1
LinkDB All DBs
Position
Unknown
AA seq 869 aa AA seqDB search
MMSKILALLSVLSIASAAPLATCPGYRVTNVQSGDSYLVADLTLAGNKCNIYSEDITNLR
LTVEYQTDTRLHVLIEDREKNVYQIQGNILPRPTSQNSSSQTTDLRFSYEANPFSFKVTR
ASTGDVLFDTSPSPLIFETQYLRLRTRLPPNPNLYGLGEHSDSFRLPTDGYKRTLWNSEA
PYIPQNQNLYGSHPVYFEHRSGTSNKGPATHGVFLRSASGMDIIIGKSDSNEQYLEYNTI
GGVFDFYFLAGPSPEQVSKQYAAAVGLPAMMPYWSLGFHQCKYGWPDLAHVKQVVANYSA
AGIPLEAVWDDIDYMDNKLDFSTDPVRYPKDQLRKFVDELHGKDMRYVQILDPGIRNKQD
YGPFKRGADKGVFLKAADGSWYRGLQWPGEVVWPDWIAPQTKEWWTTEILTFYDPNNGID
IDGLWIDMNEASNMCADTMCLSSAQDMEARSVQVHNQTPLSPRAPQHAAAPGDGQHLGLP
NRDLFTPRYQISNHYPSLSSRTLFTNITNADGTTQYDTHNLHGLFMSLTTRSALVARSPT
KRPFLLTRSTFSGSSRFAAHWFGDNFSSWADYRASIRQLLSFSAVHNYPMVGSDVCGFNG
QAQERMCARWAVLGAWHPFYRNHADVSAPDQEFYRWDVVKEAARKAVGTRYRLLDYFYTG
LHYASTRGEVLVKPVWYGWPGDENTYGIDTQFMVGDAVLVNPVVEDDTQSVSFYLPKGVW
YDFFSHDRIDQSAGGQTITVTGVNWDEISVYIRGGSILPLRLSDSLPSGSDAGQAMTTKE
VRARNFEIIVAPDANGKASGKLYLDDGESLDSSGKESEIDFSWNGKRLEARGTFGYETGV
KVVRVVVLGDAERKAEGEWGLMGSFTVDF
NT seq 2610 nt NT seq  +upstreamnt  +downstreamnt
atgatgtccaaaatcctcgcgctgctgtcggtgttgtcgatagcatccgccgcgcctctg
gcaacatgccccggataccgagtcaccaacgtccaatccggagactcgtatctcgtcgcc
gacctgactctcgccggcaacaaatgcaatatctacagtgaagatatcaccaacttgcgc
ttgaccgtggaatatcagactgacacccgtctccacgtcttaatcgaagaccgcgagaag
aacgtctaccaaatccaaggcaacatcctcccccgccccacctctcagaattccagctcc
caaaccaccgatctgcgcttttcctacgaagccaaccccttctccttcaaagtcacacgc
gccagcaccggcgacgtcctcttcgacacttctccctcacctctgatctttgagacacag
tacctccgcttgcgcacccgcttgcctcccaacccgaatttgtacggactgggtgaacac
tccgactccttccgactaccgactgatggatataagcgaacgttatggaattccgaagcg
ccgtatataccgcagaaccagaacttgtatgggagtcaccctgtgtactttgagcatcgc
tccggtaccagtaacaaaggtccagcaacgcatggcgtttttttgaggagtgcatccggt
atggacatcatcatcggaaaaagcgactccaacgagcaatacctcgagtacaacaccatc
ggcggcgtgttcgacttttatttcttggctggcccctcaccagaacaagtaagcaagcaa
tacgccgccgccgtcggtctgcccgccatgatgccctattggtctctcgggtttcatcag
tgcaaatacggctggccggacttggcgcacgtcaagcaggttgtcgcaaactacagcgct
gcggggattccgctcgaggcggtttgggatgatatcgattacatggacaataagctggat
ttcagcacggatccggtacggtatcccaaggatcagctcaggaagtttgtggatgagttg
catggcaaggatatgcggtatgtgcagattttggatccggggatcaggaataagcaagac
tatggcccgtttaagaggggggcggataagggtgttttcttgaaggcagctgatgggtct
tggtatcgtggtctgcagtggcccggggaggtggtttggccggattggatcgctccccaa
accaaagagtggtggacgacggagatcttgacgttttatgatcccaacaacgggattgat
atcgatggattgtggatcgacatgaatgaggcgagcaatatgtgcgccgacaccatgtgt
ctgtcgtcagctcaggacatggaggctcggtcagtccaagtccacaaccaaacaccactg
tctcctcgcgcaccacaacatgcagccgcaccgggagacggccaacacctcggccttccc
aaccgcgacctcttcaccccccgataccaaatatccaatcactatccatccctctcctcc
cgcactttattcacaaacatcaccaacgccgacggcacaacccaatacgacacccacaac
ctgcacggcctcttcatgtccctcaccacccgctcggccttggtcgcccgctcaccaacc
aaacgtcccttcctcctcacgcgctccaccttctcgggctcttcccggttcgcagcccac
tggttcggcgacaacttttcttcatgggccgattaccgcgcctccatccgccagcttttg
agcttcagcgcagtacacaactatcccatggtcggcagcgacgtgtgcgggttcaacggc
caggctcaagaacgcatgtgcgcgagatgggccgtgctgggggcttggcaccccttttac
aggaatcatgctgatgtgtcggcgccggatcaggagttttatcggtgggatgttgtgaag
gaggcggcgaggaaggcggtggggacaaggtacaggttgttggattatttttacacgggg
ctgcactatgctagtacgaggggggaggtgctggtgaagccggtctggtatgggtggccg
ggggatgagaatacgtacgggattgatacgcagtttatggtcggggacgcggttttggtg
aatcccgtggtggaggatgatacacaatctgtcagcttttatttgccaaagggggtttgg
tatgatttcttttctcatgatcgcatcgatcagagcgcaggtggacaaacgattaccgtc
actggcgttaactgggacgagatatcggtttacattcgcggggggagtatacttcctctt
cgcctttccgactctctaccctccggctctgatgcaggccaggcgatgaccaccaaggaa
gtccgcgctagaaactttgagataatcgtggcgcctgatgccaacgggaaggcaagtggg
aaattgtatctagatgatggcgaaagtctggattcgagtgggaaggagagcgagattgac
ttcagttggaatgggaagaggttggaagctagggggacgtttgggtatgagacgggggtc
aaggtggtgagggttgtggttttgggggatgcggagaggaaggcggagggtgaatggggg
ttgatggggagttttacggttgatttctag

DBGET integrated database retrieval system