KEGG   Sinorhizobium meliloti BL225C: SinmeB_0751Help
Entry
SinmeB_0751       CDS       T01884                                 

Definition
(GenBank) Alanine racemase
  KO
K01775  alanine racemase [EC:5.1.1.1]
Organism
smq  Sinorhizobium meliloti BL225C
Pathway
smq00473  D-Alanine metabolism
smq01100  Metabolic pathways
smq01502  Vancomycin resistance
Brite
KEGG Orthology (KO) [BR:smq00001]
 09100 Metabolism
  09106 Metabolism of other amino acids
   00473 D-Alanine metabolism
    SinmeB_0751
 09160 Human Diseases
  09168 Drug resistance
   01502 Vancomycin resistance
    SinmeB_0751
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01011 Peptidoglycan biosynthesis and degradation proteins [BR:smq01011]
    SinmeB_0751
Enzymes [BR:smq01000]
 5. Isomerases
  5.1  Racemases and epimerases
   5.1.1  Acting on amino acids and derivatives
    5.1.1.1  alanine racemase
     SinmeB_0751
Peptidoglycan biosynthesis and degradation proteins [BR:smq01011]
 Precursor biosynthesis
  Racemase
   SinmeB_0751
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Ala_racemase_N Ala_racemase_C
Motif
Other DBs
NCBI-ProteinID: AEG03685
UniProt: A0A0E0UBP1
LinkDB All DBs
Position
complement(792014..793153)
Genome map
AA seq 379 aa AA seqDB search
MQSPEFLSASSRLTVDLTALADNWRAMNERSGKARAAAVLKADAYGLGVVHAAPALYAAG
ARDFFVASVEEGADLRPLVPDGRIYILAGMWPGNEELFFENDLVPIINSEEQLAVFMAAL
SERGDHPCVLHVDTGMNRLGLSPEEALALAHDPARPASFSPVLVMSHLACADDPGHPMNR
YQLQRFREVTAAFEGVPASLANSGGVFLGADYHFDLTRPGIAVYGGEAVNGAVNPMKAVV
TAEARIVQVRTVPSGGTASYGASVRFGRDSRIATVAIGYADGYHRSVSGGGVTLRQAMPS
GAFGFLHGMKVPHVGRVTMDLSLFDVTDLPEAAVRAGDYIEVFGRNVVIDDVARAGGTIG
YELLTSLGRRYHRTYVGGA
NT seq 1140 nt NT seq  +upstreamnt  +downstreamnt
atgcaaagccccgagtttctttccgcctccagcaggctcaccgtcgacctcaccgcgctc
gccgacaattggcgggcgatgaacgagcggtccggaaaagcccgcgccgccgccgttctg
aaggccgatgcctacggtctcggcgtcgtgcatgccgctccggctctctatgccgccggc
gcgcgcgatttcttcgtggccagtgtcgaagaaggggccgatcttcgcccgcttgttccg
gatgggcgaatctacattctcgcgggaatgtggcccggcaacgaggagctcttcttcgag
aacgatctcgtgccgatcatcaactcggaagagcagctggcggtcttcatggcagcgctt
tccgaacggggcgaccacccctgcgttctccacgtcgacacgggcatgaaccggctcggc
ctgtcgcctgaggaggcgcttgccctcgcccacgaccctgcgcggcctgcgagtttctcg
ccggtcctcgtcatgagccatctggcctgcgccgacgatcccggacacccgatgaaccgc
tatcagcttcagcgtttccgcgaggtgaccgccgccttcgagggcgtgccggcgagcctt
gcaaattccggcggcgtgttcctcggtgcggactaccacttcgacctcacccggcccggc
atcgcggtctatggcggcgaggcggtaaatggcgcggtcaatccgatgaaagcggtcgtc
accgccgaagcgcgcatcgtgcaggtcaggacggttccatccggcggaacggcaagctac
ggcgcctcggtccgcttcggccgcgacagccgcattgcgacggtcgcgatcggctatgcc
gacggctaccaccgttcggtttcgggcggcggcgtcaccctcagacaggcgatgccctcg
ggcgccttcggtttcctgcatggtatgaaggtgccgcatgtcggtcgggtgacgatggat
ctgagcctgttcgatgtcacggacctgccggaagcggccgtacgtgccggcgattatatc
gaggtcttcgggcgcaatgtcgtcatcgacgacgtcgcgcgcgccggcggtaccatcggc
tacgagctgctgacgagcctcggccggcgctatcatcggacctatgtcggaggcgcttga

DBGET integrated database retrieval system