KEGG   Sinorhizobium meliloti BL225C: SinmeB_0940Help
Entry
SinmeB_0940       CDS       T01884                                 

Definition
(GenBank) Aspartyl/glutamyl-tRNA(Asn/Gln) amidotransferase subunit B
  KO
K02434  aspartyl-tRNA(Asn)/glutamyl-tRNA(Gln) amidotransferase subunit B [EC:6.3.5.6 6.3.5.7]
Organism
smq  Sinorhizobium meliloti BL225C
Pathway
smq00970  Aminoacyl-tRNA biosynthesis
smq01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:smq00001]
 09120 Genetic Information Processing
  09122 Translation
   00970 Aminoacyl-tRNA biosynthesis
    SinmeB_0940
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03029 Mitochondrial biogenesis [BR:smq03029]
    SinmeB_0940
Enzymes [BR:smq01000]
 6. Ligases
  6.3  Forming carbon-nitrogen bonds
   6.3.5  Carbon-nitrogen ligases with glutamine as amido-N-donor
    6.3.5.6  asparaginyl-tRNA synthase (glutamine-hydrolysing)
     SinmeB_0940
    6.3.5.7  glutaminyl-tRNA synthase (glutamine-hydrolysing)
     SinmeB_0940
Mitochondrial biogenesis [BR:smq03029]
 Mitochondrial DNA transcription, translation, and replication factors
  Mitochondrial transcription and translation factors
   Other mitochondrial DNA transcription and translation factors
    SinmeB_0940
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: GatB_N GatB_Yqey
Motif
Other DBs
NCBI-ProteinID: AEG03870
UniProt: A0A0E0UC82
LinkDB All DBs
Position
993943..995445
Genome map
AA seq 500 aa AA seqDB search
MSIVDVRTPDPKRFIPGATGDWEVIIGMEVHAQVLSNSKLFSSASTEFGSEPNANVSLVD
AAMPGMLPVINEECVKQAVRTGLGLKAKINNRSIFDRKNYFYPDLPQGYQISQYKDPIVG
EGKIIISVGPDRQGQFEDVEIGIERLHLEQDAGKSMHDQHPAMSYVDLNRSGVALMEIVS
KPDLRSSDEAKAYLTKLRSILRYLGTCDGNMDEGSMRADVNVSVRRPGEAFGTRCEIKNV
NSIRFVGQSIEYEARRQIAILEDGGAIDQETRLFDANKGETRSMRSKEEAHDYRYFPDPD
LLPLEFDDAFVEALKADLPELPDDKKERFVRDLGLSVYDASVLVSEKAIADYFEAVAEGR
DGKAAANWVINDLLGALNKAGKTIEETPVSPAQLGGIIDLIKDGTISGKLAKDVFEILWN
EGGDPAEIVESRGMKQVTDTGAIEKAVDEIIAANPDQVEKAKAKPSLAGWFVGQVMKATG
GKANPQAVQALVKSKLGIEE
NT seq 1503 nt NT seq  +upstreamnt  +downstreamnt
atgagcatcgtcgacgtccgcactcctgatccgaaacgcttcattccaggcgccaccggc
gactgggaggtcatcatcggcatggaggtccatgcgcaggtgctgagcaattcgaagctg
ttctccagtgcgtcgaccgagttcggatcggagccgaatgccaatgtttcgctcgtcgat
gccgcaatgccgggcatgcttccggtcatcaacgaggaatgcgtcaagcaggccgtgcgc
accggcctgggcttgaaggcaaagatcaacaatcgctcgatcttcgaccggaagaactat
ttctatccggacctgccgcagggctaccagatctcgcaatacaaggacccgatcgtcggc
gagggcaagatcatcatttccgtcggtccggaccgccaggggcagttcgaagacgtcgag
atcggcatcgagcgcctgcatctggagcaggatgccggcaagtcgatgcacgaccagcat
cccgccatgtcctatgtcgacctcaaccggtcgggcgtcgcgctgatggagatcgtctcg
aagccggacctgcgttcgtcggacgaggcgaaagcctatctcaccaagcttcgctcgatc
ctgcgttatctcggcacctgcgacggcaatatggacgagggctcgatgcgcgcggacgtc
aacgtctcggttcgccgtccgggcgaagctttcggcacgcgctgcgaaatcaagaacgtc
aactcgatccgcttcgtcggccagtcgatcgagtacgaggcccgtcgccagatcgcgatc
cttgaagacggcggcgcgatcgaccaggagacccggctcttcgatgccaacaagggcgag
acccgctccatgcgttcgaaggaagaggcgcacgactaccgctacttccccgatccggat
ctcctgccgctcgagtttgacgatgccttcgtggaagcgctcaaggccgaccttcccgaa
ttgccggacgacaagaaggaacgcttcgttcgcgatctcggcctgtccgtttacgatgcg
tccgttctcgtctcggaaaaggcgattgccgattacttcgaagccgtggccgaaggccgt
gacggcaaggcggcggcgaactgggtgatcaacgatcttctcggcgcgctgaacaaggcc
ggcaagaccatcgaggaaacgccggtctcgccggcgcagctcggcggcatcatcgatctc
atcaaggatggcaccatttccggcaagctcgcaaaggacgtcttcgaaatcctttggaac
gagggaggcgatccggccgaaatcgtcgagagccgcggtatgaagcaggtcaccgacacc
ggtgcgatcgagaaggcggtcgacgagatcatcgccgccaatcccgaccaggtggaaaag
gccaaggcgaagccgtcgctcgccggctggttcgtcgggcaggtgatgaaggcgaccggc
ggcaaggccaatccgcaggcggtgcaggccctggtaaaatccaaactcggcatcgaggag
tga

DBGET integrated database retrieval system