KEGG   Sinorhizobium meliloti BL225C: SinmeB_1995Help
Entry
SinmeB_1995       CDS       T01884                                 

Definition
(GenBank) D-alanine--D-alanine ligase
  KO
K01921  D-alanine-D-alanine ligase [EC:6.3.2.4]
Organism
smq  Sinorhizobium meliloti BL225C
Pathway
smq00473  D-Alanine metabolism
smq00550  Peptidoglycan biosynthesis
smq01100  Metabolic pathways
smq01502  Vancomycin resistance
Brite
KEGG Orthology (KO) [BR:smq00001]
 09100 Metabolism
  09106 Metabolism of other amino acids
   00473 D-Alanine metabolism
    SinmeB_1995
  09107 Glycan biosynthesis and metabolism
   00550 Peptidoglycan biosynthesis
    SinmeB_1995
 09160 Human Diseases
  09175 Drug resistance: antimicrobial
   01502 Vancomycin resistance
    SinmeB_1995
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01011 Peptidoglycan biosynthesis and degradation proteins [BR:smq01011]
    SinmeB_1995
Enzymes [BR:smq01000]
 6. Ligases
  6.3  Forming carbon-nitrogen bonds
   6.3.2  Acid-D-amino-acid ligases (peptide synthases)
    6.3.2.4  D-alanine---D-alanine ligase
     SinmeB_1995
Peptidoglycan biosynthesis and degradation proteins [BR:smq01011]
 Precursor biosynthesis
  Amino acid ligase
   SinmeB_1995
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Dala_Dala_lig_C Dala_Dala_lig_N ATP-grasp_4 GARS_A CPSase_L_D2 ATP-grasp_3 ATPgrasp_ST
Motif
Other DBs
NCBI-ProteinID: AEG04900
UniProt: A0A0E0UF60
LinkDB All DBs
Position
complement(2052082..2053008)
Genome map
AA seq 308 aa AA seqDB search
MSSKHVAVLLGGFSSERPVSLSSGTACADALEAEGYRVTRVDVGRDVAAVLQELRPDVVF
NALHGPFGEDGTIQGILEYLEIPYTHSGVLASALAMDKDQAKHVAKAAGIPVAEALVMDR
RSFGNQHPMKPPYVVKPVREGSSFGVVIVKEDQSHPPQVITSSEWRYGDRVMVERYIAGR
EFTCGVMGDVALGVTEIIPQGHAFYDYDSKYVKGGSKHVIPAQISPNIYQKIQTLALKAH
QAIGCRGVSRSDFRFDDRGDGEGELIWLEINTQPGMTPTSLVPEMAQHAGLQFGEFLRWM
VEDASCLR
NT seq 927 nt NT seq  +upstreamnt  +downstreamnt
atgagcagcaagcatgttgctgtcctgttgggcggattttcctcggagaggccggtgagc
ctgtcttcggggactgcttgcgcggatgccctggaggccgaaggctatcgcgtcacgcgc
gtcgatgtcggtcgcgacgtcgcggcggttcttcaggaattgcgtccggatgtcgtcttc
aacgcgcttcatgggccgttcggcgaggacgggacgatccagggcattctcgaatatctc
gagattccctatacccattcgggcgttttggcctcggcgctggccatggataaagatcag
gcaaagcatgtcgccaaggctgccggcattccggttgccgaagccttggtcatggaccgg
cgcagcttcggcaatcagcacccgatgaagccgccttacgtggtgaagccggtccgcgag
gggtcgagcttcggagtggtgatcgtcaaggaggatcagtcgcatccgcctcaggtgatc
acctcgagcgagtggcgctacggcgaccgcgtcatggtcgagcgctatattgcggggcgc
gaattcacctgcggtgtcatgggcgacgtcgccctcggcgtcactgaaatcattccgcag
gggcacgccttctacgattacgactcgaaatacgtaaaaggtggttcgaagcacgtcata
cctgcacagatttcaccaaatatttaccaaaaaatacaaacactggcgttgaaggcgcat
caggcgatcggttgccgcggcgtcagccggtccgactttcgtttcgacgatcgtggggat
ggtgagggcgagttgatctggctcgagatcaacacccaacccggcatgaccccaacatcc
ctggtgcccgaaatggcgcagcatgctggccttcagttcggtgaatttctcaggtggatg
gtggaggacgcgtcgtgcttgcgctga

DBGET integrated database retrieval system