KEGG   Sinorhizobium meliloti BL225C: SinmeB_2178Help
Entry
SinmeB_2178       CDS       T01884                                 

Definition
(GenBank) Aldehyde Dehydrogenase
  KO
K00138  aldehyde dehydrogenase [EC:1.2.1.-]
Organism
smq  Sinorhizobium meliloti BL225C
Pathway
smq00010  Glycolysis / Gluconeogenesis
smq00620  Pyruvate metabolism
smq01100  Metabolic pathways
smq01110  Biosynthesis of secondary metabolites
smq01120  Microbial metabolism in diverse environments
Brite
KEGG Orthology (KO) [BR:smq00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    SinmeB_2178
   00620 Pyruvate metabolism
    SinmeB_2178
Enzymes [BR:smq01000]
 1. Oxidoreductases
  1.2  Acting on the aldehyde or oxo group of donors
   1.2.1  With NAD+ or NADP+ as acceptor
    1.2.1.-  
     SinmeB_2178
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Aldedh
Motif
Other DBs
NCBI-ProteinID: AEG05081
UniProt: A0A0E0UEP0
LinkDB All DBs
Position
complement(2251484..2252992)
Genome map
AA seq 502 aa AA seqDB search
MLHQKIVENPYKQKYGNFIGGEWREPVAGRYFDNTTPITGGTLCEVARSDAADIEIALDA
AHAAREKWGRTSTTERSNILMKIAARMEDNLELLARAETWDNGKPIRETMAADIPLAIDH
FRYFAACIRAQEGSIGEIDHDTVAYHFHEPLGVVGQIIPWNFPILMAAWKLAPALAAGNC
VVLKPAEQTPGSILVWAELIGDLLPPGVLNIVNGFGLEAGKPLATSPRIAKIAFTGETTT
GRLIMQYASQNLIPVTLELGGKSPNIFFADVASEDDDFFDKALEGFAMFALNQGEVCTCP
SRALVQESIYDRFMERAVKRVEAIRQGNPLDEATMIGAQASSEQLEKILAYIEIGKEEGA
EVLTGGGRNVLEGDLSGGYYVKPTVFHGHNRMRIFQEEIFGPVVSVTTFKTEAEALEIAN
DTLYGLGAGVWSRDANRCYRFGRAIEAGRVWTNCYHAYPAHAAFGGYKQSGIGRETHKMM
LDHYQQTKNMLVSYSPKALGFF
NT seq 1509 nt NT seq  +upstreamnt  +downstreamnt
atgctgcatcagaagatcgtcgagaacccctacaagcagaaatacgggaacttcatcggc
ggcgaatggcgcgaacccgttgcaggccgctatttcgacaacacgacgccgatcaccggc
ggcacgctttgcgaggtcgcgcgttcggacgccgccgacatcgagatcgccctcgacgcg
gcgcacgccgcaagggagaaatggggccggacctcgacgacggagcggtcgaacattctg
atgaagatcgccgcccgcatggaggacaatctggagcttctggcacgggcggaaacctgg
gacaacggcaagccgatccgcgagacgatggccgccgacattccgctggcgatcgatcat
ttccgctatttcgcggcctgcatccgtgcacaggaaggctcgatcggcgagatcgaccac
gacaccgtcgcctaccatttccacgagccgctcggcgtcgtcggccagatcattccctgg
aacttcccgatcctgatggccgcctggaagcttgcgccggcgcttgccgccggaaactgc
gtcgtgctgaagccggccgagcagacgccgggctcgatcctcgtctgggcggaactcatc
ggtgacctcctgccgccgggtgtcctcaacatcgtcaacggcttcggcctcgaagcgggc
aagccgctcgccaccagcccgcgcatcgccaagatcgcttttaccggcgagacgacgacc
gggcggctgatcatgcaatatgccagccagaacctcatcccggtcacgctggagctcggc
ggaaagtcgccgaacatcttcttcgcggacgtcgccagcgaggacgacgacttcttcgac
aaggcgctggaaggcttcgccatgttcgcgctgaaccagggcgaggtctgcacctgcccg
agccgggcactggtacaggagagcatctacgaccgcttcatggagcgggcggtaaagagg
gtcgaggcgatccggcagggcaatccgctcgatgaagcaaccatgatcggcgcccaggct
tcgagcgaacagctcgagaaaatcctcgcctatatcgaaatcggcaaggaggaaggtgcc
gaggtgctgaccggcggcgggcgcaacgtgctcgaaggcgatctttccggcggctactac
gtcaagccgaccgtattccacggccacaacaggatgcgcatctttcaggaggagattttc
gggccggtcgtgtcggtcacgaccttcaagacggaagccgaggcgctggaaatcgccaac
gacacgctctacgggcttggcgccggcgtgtggagccgcgatgccaaccgctgctaccgc
ttcggccgcgcgatcgaagccggccgggtctggaccaattgctaccacgcctatccggcg
cacgccgccttcggcggttacaagcagtccggcatcgggcgcgagacgcacaagatgatg
ctggatcactatcagcagacgaagaacatgctggtcagctacagcccgaaggctctcggc
ttcttctga

DBGET integrated database retrieval system