KEGG   Sinorhizobium meliloti BL225C: SinmeB_2224Help
Entry
SinmeB_2224       CDS       T01884                                 

Definition
(GenBank) Thymidine kinase
  KO
K00857  thymidine kinase [EC:2.7.1.21]
Organism
smq  Sinorhizobium meliloti BL225C
Pathway
smq00240  Pyrimidine metabolism
smq01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:smq00001]
 09100 Metabolism
  09104 Nucleotide metabolism
   00240 Pyrimidine metabolism
    SinmeB_2224
Enzymes [BR:smq01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.21  thymidine kinase
     SinmeB_2224
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: TK AAA_30 AAA_22 KdpD
Motif
Other DBs
NCBI-ProteinID: AEG05125
UniProt: A0A0E0UFU6
LinkDB All DBs
Position
complement(2302457..2303128)
Genome map
AA seq 223 aa AA seqDB search
MSKLYFSYATMNAGKSTLLLQAAYNYQERGMRVVMLIAAFDDRAGQGRIASRIGLESEAI
PFRAEDDLHGLIERLNGDGSGEIACVFVDEAQFLGEDQVWQLARVADRLGIPVMAYGLRT
DFQGKLFPGSMALLAIADELREVRTICHCGRKATMVVRLDGRGKVMREGAQVDVGGNEKY
VSYCRRHWDDRMREGRRASRPAAMHRPCCPALEKAATALVVPC
NT seq 672 nt NT seq  +upstreamnt  +downstreamnt
atgtccaaactttatttcagctatgcgacgatgaatgccggcaagagcacgctgctcctg
caggccgcctacaactatcaggagcgcggcatgcgcgtcgtgatgctgatagcagccttc
gacgatcgcgccggccagggtcgcatcgcgtctcgcatcgggctggaatcggaggcgatc
cccttccgcgcagaggatgatctccatgggctgatcgagcgcctgaacggcgacggctcc
ggtgaaatcgcctgcgtcttcgtggacgaggcgcagttcctcggtgaagatcaggtctgg
cagttggcgcgtgtggcggatcgcctcggcattccggtcatggcctatggcctgaggacg
gacttccagggcaagctcttccccggctccatggctctgctcgctatcgcggatgagttg
cgcgaagtcaggaccatctgccattgcgggcgcaaggcaacgatggtcgtccgcctcgac
ggccgcggcaaggtcatgcgggagggcgcgcaggtggatgtcggcggcaacgagaaatac
gtctcctattgccgtcgccattgggacgaccggatgcgcgaaggccgacgcgcaagccga
ccggcggcgatgcaccggccctgctgccctgcactcgaaaaagcggccaccgcccttgtc
gttccgtgctaa

DBGET integrated database retrieval system