KEGG   Sinorhizobium meliloti BL225C: SinmeB_3045Help
Entry
SinmeB_3045       CDS       T01884                                 

Definition
(GenBank) ABC-type transporter, periplasmic subunit family 3
  KO
K02424  L-cystine transport system substrate-binding protein
Organism
smq  Sinorhizobium meliloti BL225C
Pathway
smq02010  ABC transporters
Brite
KEGG Orthology (KO) [BR:smq00001]
 09130 Environmental Information Processing
  09131 Membrane transport
   02010 ABC transporters
    SinmeB_3045
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:smq02000]
    SinmeB_3045
   02035 Bacterial motility proteins [BR:smq02035]
    SinmeB_3045
Transporters [BR:smq02000]
 ABC transporters, prokaryotic type
  Phosphate and amino acid transporters
   Cystine transporter
    SinmeB_3045
Bacterial motility proteins [BR:smq02035]
 Flagellar system
  Flagellar assembly proteins
   Chaperones
    SinmeB_3045
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: SBP_bac_3 Lig_chan-Glu_bd Phosphonate-bd NMT1 ADH_zinc_N
Motif
Other DBs
NCBI-ProteinID: AEG05942
UniProt: A0A0E0UGZ1
LinkDB All DBs
Position
3182802..3183575
Genome map
AA seq 257 aa AA seqDB search
MKLLPTLFAAALLQFAAFVPAEAGQNLDEVKSAGVLKIGTEGTYAPFTYHDASGALVGFD
VEIGQEVAKRLGVKPEFLEGKWDGLIAGLDANRYDAVINQVGITEERKKKYDFSEPYIAS
KAVLIVRGDDEEIKDFADLKGKKSAQSLTSNFGKLAQASGAELVGTDGFDQSIQLVLTGR
ADATINDSLSFLDFKKQKPDANVKIAAEKPDADYSGIIIRKGEPELLEAINKALAEIKAD
GTYEKISQKYFGADVSK
NT seq 774 nt NT seq  +upstreamnt  +downstreamnt
atgaaactccttccgacgctttttgccgccgcactcctgcaattcgccgccttcgttccc
gctgaggcggggcagaacctggacgaggtcaagtccgcaggcgtgctgaagatcggcacc
gagggcacctacgcccccttcacctatcatgacgcgagcggcgctctcgtcggcttcgac
gtcgagatcggccaggaagtcgccaagcgcctcggcgtcaagccggaattcctggaaggc
aagtgggatggactgatcgccggcctcgacgccaaccgttacgacgctgtcatcaaccag
gtcggcatcaccgaggagcgcaagaagaaatacgatttctccgaaccctatatcgcctcc
aaggccgtgctgatcgtccgcggcgacgacgaggagatcaaggacttcgccgacctgaag
ggcaagaaatcggcacagtcgctgaccagcaacttcggcaagctcgcgcaagcctcgggc
gccgagctcgtcggaaccgacggtttcgaccagtcgatccagctcgtgctgacgggccgc
gccgacgcgaccatcaatgacagcctctccttcctcgacttcaagaagcagaagccggat
gcgaatgtgaagatcgccgccgaaaagcccgatgccgattattcgggcatcatcatccgc
aagggcgagccggagctgctcgaagcgatcaacaaggcgctggccgagatcaaggccgac
ggcacctatgagaagatctcgcagaaatatttcggcgccgacgtttcgaaatag

DBGET integrated database retrieval system