KEGG   Sinorhizobium meliloti BL225C: SinmeB_3351Help
Entry
SinmeB_3351       CDS       T01884                                 

Definition
(GenBank) Beta-ketoacyl-acyl-carrier-protein synthase I
  KO
K00647  3-oxoacyl-[acyl-carrier-protein] synthase I [EC:2.3.1.41]
Organism
smq  Sinorhizobium meliloti BL225C
Pathway
smq00061  Fatty acid biosynthesis
smq00780  Biotin metabolism
smq01100  Metabolic pathways
smq01212  Fatty acid metabolism
Module
smq_M00083  Fatty acid biosynthesis, elongation
Brite
KEGG Orthology (KO) [BR:smq00001]
 09100 Metabolism
  09103 Lipid metabolism
   00061 Fatty acid biosynthesis
    SinmeB_3351
  09108 Metabolism of cofactors and vitamins
   00780 Biotin metabolism
    SinmeB_3351
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01004 Lipid biosynthesis proteins [BR:smq01004]
    SinmeB_3351
Enzymes [BR:smq01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.41  beta-ketoacyl-[acyl-carrier-protein] synthase I
     SinmeB_3351
Lipid biosynthesis proteins [BR:smq01004]
 Fatty acid synthase
  Component type
   SinmeB_3351
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ketoacyl-synt Ketoacyl-synt_C Thiolase_N KAsynt_C_assoc
Motif
Other DBs
NCBI-ProteinID: AEG06246
UniProt: A0A0E0UHZ6
LinkDB All DBs
Position
complement(3554344..3555564)
Genome map
AA seq 406 aa AA seqDB search
MRRVVVTGLGIVSSIGSDADEVTASLRDARSGITFSPDFAEHGFKCQVWGAPTLDPSDLV
DRRAMRFLSQGGAWNHVAMKQAIADSGLEAGDITNERTGIIMGSGGPSTRAIVEAAEITR
KNNSPKRIGPFVVPKAMSSTASATLATWFQIHGVNYSISSACSTSAHCIGNAAEMIQWGK
QDVMFAGGHEDLDWTMSNLFDAMGAMSSKYNDTPSVASRAYDANRDGFVIAGGAGVLVLE
ELEHAKARGAKIYAEIVGYGATSDGYDMVAPSGEGAVRCMRQALATVKGEVDYINTHGTS
TPVGDQKEIGAIREVFGEKMPHVQSTKSLTGHSLGAAGVQESIYGLLMMQAGFIGESAHI
TELDPEFEGVPIVRKRIDNAKIDTVLSNSFGFGGTNATLVFQRYNG
NT seq 1221 nt NT seq  +upstreamnt  +downstreamnt
atgagacgggttgttgtaacgggcctcggcatcgtttcctcgatcggcagcgatgccgac
gaagtcaccgcgtcgctgcgcgatgcgcggtcgggcatcacgttttctccggactttgcc
gagcacggcttcaaatgccaggtctggggagcgccgacgctcgacccgagcgacctcgtc
gaccgccgcgccatgcgcttcctgtcccagggcggcgcctggaaccatgtggcgatgaag
caggcgatcgccgattccgggctcgaggccggcgacatcaccaatgagcgcaccggcatc
atcatgggctcgggcggcccttctacccgcgcgatcgtcgaagcggcggagatcacccgc
aagaacaacagcccgaagcggatcggccccttcgtggtgccgaaggcgatgtcgtctacg
gcttcggcgacgctcgcgacctggttccagatccacggcgtcaactactcgatctcgtcg
gcctgctcgacttcggcgcattgcatcggcaatgccgcggaaatgatccagtggggcaag
caggacgtcatgttcgcgggcggccatgaagatctcgactggaccatgtccaatcttttc
gacgccatgggcgccatgtcgtcgaagtacaacgacacgccgtccgtcgcgtcgcgcgcc
tatgacgcgaaccgcgacggcttcgtcatcgccggcggtgccggcgttctcgttctggaa
gagctggagcacgccaaggcgcgcggcgccaaaatctatgcggaaatcgtcggttacggc
gccacttcggacggctacgacatggtcgcgccatcaggcgaaggcgcggttcgctgcatg
cgccaggcgctggccaccgtgaagggcgaggtcgactacatcaatacccacggcacctcg
acgccggtcggcgatcagaaggagatcggcgccatccgcgaggtcttcggcgagaagatg
ccgcatgtccagtccacgaaatcgctgaccggccactcgctcggcgcggccggcgtgcag
gaatcgatctacggtctcctgatgatgcaggccggcttcatcggcgaaagcgctcacatc
accgagctcgatcccgaattcgaaggggtgccgatcgtccgcaagcgcatcgacaatgcc
aagatcgacacggttctttcgaactccttcggcttcggcggcacaaacgcgacgctcgtc
ttccagcgctataacggataa

DBGET integrated database retrieval system