KEGG   Sinorhizobium meliloti BL225C: SinmeB_3409Help
Entry
SinmeB_3409       CDS       T01884                                 

Definition
(GenBank) Glutathione S-transferase domain protein
  KO
K00799  glutathione S-transferase [EC:2.5.1.18]
Organism
smq  Sinorhizobium meliloti BL225C
Pathway
smq00480  Glutathione metabolism
smq01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:smq00001]
 09100 Metabolism
  09106 Metabolism of other amino acids
   00480 Glutathione metabolism
    SinmeB_3409
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:smq02000]
    SinmeB_3409
Enzymes [BR:smq01000]
 2. Transferases
  2.5  Transferring alkyl or aryl groups, other than methyl groups
   2.5.1  Transferring alkyl or aryl groups, other than methyl groups (only sub-subclass identified to date)
    2.5.1.18  glutathione transferase
     SinmeB_3409
Transporters [BR:smq02000]
 Other Transporters
  Pores ion channels [TC:1]
   SinmeB_3409
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: GST_N_3 GST_N_2 GST_N GST_C_2 GST_C GST_C_3 Glutaredoxin GST_N_4 GST_C_5 Tom37
Motif
Other DBs
NCBI-ProteinID: AEG06303
UniProt: A0A0E0UIL7
LinkDB All DBs
Position
complement(3609766..3610452)
Genome map
AA seq 228 aa AA seqDB search
MTAQLTLISHHLCPYVQRAAIALHEKGVPFERVDIDLANKPDWFLKISPLGKVPLLRISQ
DGGEAILFESTVICEYLEETQAGPKLHPADPLARARHRGWMEFGSAILSDLWVYETTQDG
ATLEAKRNVLKSKFATVEAELGSGPYFAGSAFSLVDAVFAPIFRYFDVFDTISDSGVFQG
LPRVTAWREALAGRPSVKAAVGEDYPQRLMAFLEKHEAALLKTERVAA
NT seq 687 nt NT seq  +upstreamnt  +downstreamnt
atgacggcgcagctcaccctgatcagccaccatctctgcccctatgtgcaacgcgctgcg
attgcgctgcacgaaaaaggcgtacccttcgagcgcgtcgatatcgatctcgccaacaag
cccgactggttcctgaagatctcgccgctcggcaaggtgccgctgcttcgcatttcacag
gatggcggcgaagcgatcctcttcgagagcaccgtcatctgcgaatatctggaggaaaca
caggccggaccgaagctgcaccccgccgatccgctggcgcgggcacgccatcgcggctgg
atggagttcggctctgcaatcctctccgacctctgggtctacgaaacaacgcaggacggc
gccacgctcgaagccaaacgcaacgtgctcaagtcgaagttcgcgaccgtcgaggcggaa
ctcggcagcggcccctattttgcaggcagcgccttcagccttgtcgacgccgtcttcgcg
ccgatcttccgctatttcgacgtgttcgacacgatttccgacagcggcgtctttcagggc
ctgccgcgcgtcaccgcctggcgcgaggcgctggccgggaggccgagcgtgaaagccgcg
gtcggcgaggactacccgcagcggctgatggccttcctcgagaagcacgaggcagcgctg
ctcaagacggaaagggtggctgcctga

DBGET integrated database retrieval system