KEGG   Sinorhizobium meliloti BL225C: SinmeB_3811Help
Entry
SinmeB_3811       CDS       T01884                                 

Definition
(GenBank) 4-aminobutyrate aminotransferase
  KO
K00823  4-aminobutyrate aminotransferase [EC:2.6.1.19]
Organism
smq  Sinorhizobium meliloti BL225C
Pathway
smq00250  Alanine, aspartate and glutamate metabolism
smq00410  beta-Alanine metabolism
smq00640  Propanoate metabolism
smq00650  Butanoate metabolism
smq01100  Metabolic pathways
smq01120  Microbial metabolism in diverse environments
Brite
KEGG Orthology (KO) [BR:smq00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00640 Propanoate metabolism
    SinmeB_3811
   00650 Butanoate metabolism
    SinmeB_3811
  09105 Amino acid metabolism
   00250 Alanine, aspartate and glutamate metabolism
    SinmeB_3811
  09106 Metabolism of other amino acids
   00410 beta-Alanine metabolism
    SinmeB_3811
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01007 Amino acid related enzymes [BR:smq01007]
    SinmeB_3811
Enzymes [BR:smq01000]
 2. Transferases
  2.6  Transferring nitrogenous groups
   2.6.1  Transaminases
    2.6.1.19  4-aminobutyrate---2-oxoglutarate transaminase
     SinmeB_3811
Amino acid related enzymes [BR:smq01007]
 Aminotransferase (transaminase)
  Class III
   SinmeB_3811
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Aminotran_3 Aminotran_1_2
Motif
Other DBs
NCBI-ProteinID: AEG08119
UniProt: A0A0E0UND7
LinkDB All DBs
Position
pSINMEB02:383030..384298
Genome map
AA seq 422 aa AA seqDB search
MTSLTDRKNAAISRGVGMTTQVYADRAENAEIWDKEGNRYIDFAAGIAVVNTGHRHPKVI
AAVKAQLDRFTHTCHQVVPYENYVHLAERLNAIVPGDFAKKTIFVTTGAEAVENAVKIAR
AATGRQAVVAFGGGFHGRTFMGMALTGKVVPYKVGFGAMPADVFHAPFPIELHGVTVEQS
LSALKKLFAADVDPARVAAIIIEPVQGEGGFYPVPTAFMKALREVCDQHGILLIADEVQT
GFARTGKLFAMEHHGVAPDLTTMAKSLAGGFPLAAVTGRAEIMDAPGPGGLGGTYGGNPL
GIAAAHAVLDVIAEENLCDRANQLGNRLKQRLAAIREKAPEIVDIRGPGFMNAVEFNDVR
TNLPSAEFANKVRLLALEKGLILLTCGVHGNVIRFLAPITIQDEVFAEALDTIEASILEA
RG
NT seq 1269 nt NT seq  +upstreamnt  +downstreamnt
atgacgagcctcacagatcgcaagaacgcagccatctcccgcggtgtcggaatgaccacg
caggtctatgccgatcgcgcggaaaacgccgagatctgggacaaggaaggcaaccgctac
atcgactttgccgccggcatcgccgtggtcaatacaggccaccgccacccgaaggtgatc
gccgccgtcaaggcgcagctcgaccgcttcacccatacatgccaccaggtggtgccctac
gagaactacgtgcatctggcggagcgcctgaacgcgatcgtgcccggcgacttcgcgaag
aagaccatcttcgtcacgaccggcgcggaagccgtcgagaacgcagtgaagatcgcgcgg
gccgcgacgggccgccaggcggtcgtcgccttcggcggcggtttccatggccgcaccttc
atgggcatggcgctgacgggcaaggtcgttccgtacaaggtcggtttcggcgcgatgccg
gcagatgtcttccacgcccccttcccgatcgagcttcacggcgtgactgtcgagcagtcg
ctttcggcgctgaagaagctgttcgcggccgatgtcgatccggcccgcgtcgcagcgatc
atcatcgagccggttcagggagaaggcggcttctatccggtcccgaccgccttcatgaag
gcgcttcgcgaggtctgcgaccagcatggcatcctgctgatcgccgacgaggtgcagacc
ggatttgcccgcaccggcaagctcttcgccatggaacatcacggtgtcgcgccggacctg
acgacgatggcgaagagcctcgccggcggctttccgcttgccgccgtcaccggccgcgcc
gaaatcatggatgcgcccgggccgggcggcctcggcggcacctatggcggtaatccgctc
ggcatcgccgccgcgcatgccgtcctcgacgtgattgccgaggagaacctgtgcgatcgg
gcgaaccagctcggcaaccggctgaaacagcgccttgcggcgatccgcgagaaagcaccg
gaaatcgtcgacatccgcggacccggcttcatgaacgccgtcgaattcaacgacgtgagg
acgaacctgccgagcgccgaattcgcaaacaaggtccgcctccttgccctcgaaaagggg
ctcatcctgctgacctgcggcgtccatggcaacgtcatccgtttcctggcgccgatcacg
atccaggacgaggtcttcgcagaagccctcgacactatcgaggcatcgatcctcgaagca
cgcggttga

DBGET integrated database retrieval system