KEGG   Sinorhizobium meliloti BL225C: SinmeB_4281Help
Entry
SinmeB_4281       CDS       T01884                                 

Definition
(GenBank) Ribulose-bisphosphate carboxylase
  KO
K01601  ribulose-bisphosphate carboxylase large chain [EC:4.1.1.39]
Organism
smq  Sinorhizobium meliloti BL225C
Pathway
smq00630  Glyoxylate and dicarboxylate metabolism
smq00710  Carbon fixation in photosynthetic organisms
smq01100  Metabolic pathways
smq01120  Microbial metabolism in diverse environments
smq01200  Carbon metabolism
Module
smq_M00166  Reductive pentose phosphate cycle, ribulose-5P => glyceraldehyde-3P
Brite
KEGG Orthology (KO) [BR:smq00001]
 Metabolism
  Carbohydrate metabolism
   00630 Glyoxylate and dicarboxylate metabolism
    SinmeB_4281
  Energy metabolism
   00710 Carbon fixation in photosynthetic organisms
    SinmeB_4281
Enzymes [BR:smq01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.1  Carboxy-lyases
    4.1.1.39  ribulose-bisphosphate carboxylase
     SinmeB_4281
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: RuBisCO_large RuBisCO_large_N
Motif
Other DBs
NCBI-ProteinID: AEG08564
UniProt: A0A0E0UPQ1
LinkDB All DBs
Position
pSINMEB02:complement(890395..891651)
Genome map
AA seq 418 aa AA seqDB search
MLRITYRIETPGDVEFLAKKIASDQSTGTFVPVPGETEELKARVAARVLAIRHLEPADRA
SWPDEAGSATRFNRADAEIAFPLDAVGTDLSALMTIAIGGVYSIKGMTGIRIVDMKLPPE
FAAAHPGPQFGVVGSRRLTGVEGRPIIGTIVKPALGLRPEETAVLVGELLSSGVDFIKDD
EKLMSPAYSPLSARIAAIMPRILDHEQKTGKKVMYAFGISHTDPDEMMRNHDLVVAAGGN
AAVVNINSVGMGGVAFLRKRSGLVLHAHRNGWDILTRHGGLGMEFSVWQQFWRLLGVDQF
QINGIRVKYWEPDESFVKSFEAVSTPLFTKDDCPLPVVGSGQWGGQAPETYARTGHTTDL
LYLCGGGIVSHPGGPGAGVRAVRQAWEAAVAGIPLADYARDHPELAQSLEKFADGKGA
NT seq 1257 nt NT seq  +upstreamnt  +downstreamnt
gtgctacgcatcacctaccgcatcgagaccccgggagatgtcgaattcctggcgaagaag
atcgcaagcgaccagtcgaccggaacgttcgtgccggttccgggcgaaaccgaagagctg
aaggcgcgggtggccgcgcgcgtactggctatccgccacctcgaacccgccgatcgggcc
tcatggccggacgaggcgggaagcgccacgcgcttcaaccgcgccgatgcggagattgcc
ttcccgctcgatgcggtgggaacggatctttccgccttgatgaccattgcgatcggcggc
gtctattccatcaagggaatgaccggcatccgcatcgtggatatgaagctgccgccggag
ttcgcggctgcgcatccgggtccgcagttcggtgtcgtcggcagccggcgcctcaccggt
gtcgaaggccgcccgatcatcggcacgatcgtcaagccggcgctgggtttgcggccagag
gaaaccgccgtactcgtcggcgagctgctttcctccggggtggatttcatcaaggacgac
gagaagttgatgagcccggcctattcgccgctgagtgcgcggatagcagccatcatgccg
agaatcctcgaccacgagcagaagaccggcaagaaggtcatgtatgccttcggcatatcc
cataccgatcccgacgagatgatgcgaaaccacgatctggtggtcgcggccggcggcaat
gcggcggtcgtcaacatcaattccgtcggaatgggcggcgtcgccttcctgcgcaagcgc
tccggcctcgtgctccacgcccatcgcaacggctgggacatcctcacgcgccatggcggt
ttgggaatggagttttcggtctggcagcagttctggcggctcctcggggtggatcagttc
cagatcaacggcatccgcgtcaaatactgggagcctgacgagagcttcgtgaagtccttc
gaggcggtgagcacgccgctctttaccaaggacgattgtccgctgccggtcgtggggtcg
ggccaatggggcggacaggcgcccgagacctatgcacggaccgggcacacgaccgatctg
ctctatctctgcggcggcggcatcgtcagccatccgggcggacccggcgccggcgtcagg
gccgtacgtcaggcctgggaggcggcagtcgccgggatcccgctggcggattatgccagg
gatcaccccgaactggcgcaatcgctcgaaaaattcgccgacggcaagggcgcctga

DBGET integrated database retrieval system