KEGG   Sinorhizobium meliloti BL225C: SinmeB_4472Help
Entry
SinmeB_4472       CDS       T01884                                 

Definition
(GenBank) Ribulose-bisphosphate carboxylase
  KO
K01602  ribulose-bisphosphate carboxylase small chain [EC:4.1.1.39]
Organism
smq  Sinorhizobium meliloti BL225C
Pathway
smq00630  Glyoxylate and dicarboxylate metabolism
smq00710  Carbon fixation in photosynthetic organisms
smq01100  Metabolic pathways
smq01120  Microbial metabolism in diverse environments
smq01200  Carbon metabolism
Module
smq_M00166  Reductive pentose phosphate cycle, ribulose-5P => glyceraldehyde-3P
Brite
KEGG Orthology (KO) [BR:smq00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00630 Glyoxylate and dicarboxylate metabolism
    SinmeB_4472
  09102 Energy metabolism
   00710 Carbon fixation in photosynthetic organisms
    SinmeB_4472
Enzymes [BR:smq01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.1  Carboxy-lyases
    4.1.1.39  ribulose-bisphosphate carboxylase
     SinmeB_4472
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: RuBisCO_small
Motif
Other DBs
NCBI-ProteinID: AEG08754
UniProt: A0A0E0UQ86
LinkDB All DBs
Position
pSINMEB02:1091429..1091818
Genome map
AA seq 129 aa AA seqDB search
MRITQGCFSFLPDLTDEQITAQVEYCLGKGWAIGVEYTDDPHPRNTYWEMWGNPMFDLKD
AKGVMMELEDCRKAHPQDYIRLNAFDSSRGLETVTMSFIVNRPENEPSLRMTRTESNGRS
QHYMWETQR
NT seq 390 nt NT seq  +upstreamnt  +downstreamnt
atgcgtatcacccagggatgcttctcgttcctgccggacctgaccgacgagcagatcacg
gcgcaggtggaatattgccttggaaagggttgggctatcggcgtcgagtataccgacgac
cctcatcccagaaacacctattgggaaatgtggggcaatccgatgttcgacctcaaggat
gccaaaggcgtgatgatggagctggaggattgccgcaaggcccatccgcaggactatatc
cgcctcaacgccttcgattccagccgcggcctggagacggtgacgatgtcgttcatcgtc
aaccgtcccgaaaacgagccgagcctcaggatgacccggacggagagcaacggccgcagc
cagcactatatgtgggaaacgcagcgatag

DBGET integrated database retrieval system