KEGG   Staphylothermus marinus: Smar_0258Help
Entry
Smar_0258         CDS       T00485                                 

Definition
(GenBank) FAD dependent oxidoreductase
  KO
K00111  glycerol-3-phosphate dehydrogenase [EC:1.1.5.3]
Organism
smr  Staphylothermus marinus
Pathway
smr00564  Glycerophospholipid metabolism
smr01110  Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:smr00001]
 09100 Metabolism
  09103 Lipid metabolism
   00564 Glycerophospholipid metabolism
    Smar_0258
Enzymes [BR:smr01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.5  With a quinone or similar compound as acceptor
    1.1.5.3  glycerol-3-phosphate dehydrogenase
     Smar_0258
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: DAO Fer2_BFD Pyr_redox_2 NAD_binding_8 Pyr_redox TrkA_N Thi4 Pyr_redox_3 Sacchrp_dh_NADP NAD_binding_9 Lycopene_cycl AlaDh_PNT_C K_oxygenase Phage_cap_E UPF0180 FAD_binding_2 HI0933_like FAD_binding_3 3HCDH_N NAD_binding_7 DUF1188
Motif
Other DBs
NCBI-ProteinID: ABN69371
UniProt: A3DL61
LinkDB All DBs
Position
274482..275960
Genome map
AA seq 492 aa AA seqDB search
MYRVIIIGAGIVGLSIARVLSRFENLKITVIDKNPDVGWGVSKANTSIIHPCHEEDPDKH
PLRTKLCLEGHNIWYKWVRELDIPNRWPGEIIVATNEDEYHVLKHYLELARRNNVPGVRI
VDGEELFKLEPSINRSSIAGLYAPSAGSIDPVQACIALAENNVDNGVRFVLGEKVVDIVV
KDKHVKEVVTNNNVYEADIVINAAGLFADEIARMVGINDYIIYPRRGQYILFDKTASPKP
DKIIHTTPTPKTKGVYVLKTIEETLLIGPTAEDLSIEEKEANIVTKEGISFILENAKKII
EKLPPMNLVIRTFTGIRPEPPNGSYILRFHEEPWGFVEAAGIRSPGLTAAPAIAYYIKNL
ISQHIDLKLKKKWIRIRKGIIKIKDLSRIERNNLIKQNPKYGRIICQCMGVSEAEILEAI
NRMRKIGVKETTLDGIKFRTHSMYGRCQGTFCRPLISLIVSRETGLEPWKVSFKGGNSTY
GIGFVKELFMKR
NT seq 1479 nt NT seq  +upstreamnt  +downstreamnt
atgtatagagttataattattggagcaggcattgttggcttaagcattgccagggtctta
tcacgttttgaaaaccttaagatcactgttatcgataaaaatcctgatgtgggatggggt
gttagtaaagctaatacttcaattattcatccatgccacgaagaggatcccgacaaacat
cctttgagaacaaagctttgcctagaaggacataatatatggtataaatgggtccgtgaa
ctagatataccgaataggtggccaggcgagataatcgttgcaacaaatgaagatgaatac
catgtattaaaacattatctcgaactagctaggagaaataatgttccaggcgttaggatt
gttgatggagaggagcttttcaagttagagccgagtataaataggagtagtatagcagga
ctatatgctccatcagctggctcaatagatcctgttcaagcatgtatagctttagctgag
aacaatgtagataatggtgtaagatttgttttaggagaaaaagttgttgatatagttgtt
aaagataaacatgtcaaggaagtggttacaaataataatgtttatgaagcagacatagtt
attaatgctgctgggttatttgctgatgaaatagctcgtatggtgggtataaatgattac
ataatctatcctagaagaggtcaatacatattatttgataaaacagctagtcctaaacca
gacaaaataatacatacaacgccaacacctaaaacaaaaggagtatatgtattgaaaaca
attgaagaaacactacttataggtcccacagcagaagatttatcaatagaggagaaggaa
gcaaacattgttactaaggaaggaataagcttcattcttgaaaatgctaagaaaataatt
gagaaactacctcccatgaatctagttattagaacatttacaggaataaggccggagcct
ccgaatggatcatatattcttagatttcacgaggaaccatggggatttgttgaggcagca
ggaataagatcgcctggtttaacagctgctccagcaattgcatactatataaaaaacctg
atctctcaacacatagatcttaagctgaaaaagaaatggatacgtatacgtaaaggaatc
attaagatcaaggatcttagtagaatcgaaagaaataacttgataaaacagaacccaaaa
tacggtagaataatttgtcaatgcatgggtgtttcagaagctgagatcttagaggcaatt
aataggatgagaaagataggtgttaaggaaacaacacttgacggcattaaatttagaaca
cactctatgtatggtaggtgccaaggaacattctgcagaccactaatatccctaatagtt
tcgagagaaacaggcttagagccttggaaagtttctttcaagggaggaaacagcacatat
ggtattggatttgtcaaggaattatttatgaagaggtga

DBGET integrated database retrieval system