KEGG   Staphylothermus marinus: Smar_0492Help
Entry
Smar_0492         CDS       T00485                                 

Definition
(GenBank) Orotidine 5'-phosphate decarboxylase
  KO
K08093  3-hexulose-6-phosphate synthase [EC:4.1.2.43]
Organism
smr  Staphylothermus marinus
Pathway
smr00030  Pentose phosphate pathway
smr00680  Methane metabolism
smr01100  Metabolic pathways
smr01120  Microbial metabolism in diverse environments
smr01200  Carbon metabolism
smr01230  Biosynthesis of amino acids
Module
smr_M00580  Pentose phosphate pathway, archaea, fructose 6P => ribose 5P
Brite
KEGG Orthology (KO) [BR:smr00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00030 Pentose phosphate pathway
    Smar_0492
  09102 Energy metabolism
   00680 Methane metabolism
    Smar_0492
Enzymes [BR:smr01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.2  Aldehyde-lyases
    4.1.2.43  3-hexulose-6-phosphate synthase
     Smar_0492
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: OMPdecase Ribul_P_3_epim His_biosynth NanE ThiG PcrB IMPDH PEP_mutase Trp_syntA TMP-TENI Oxidored_nitro
Motif
Other DBs
NCBI-ProteinID: ABN69600
UniProt: A3DLU0
LinkDB All DBs
Position
complement(502484..503137)
Genome map
AA seq 217 aa AA seqDB search
MKPILQVALDVDDLFKALSLSTRIVAELGCGNIWMEAGTPLIKAWGRIGVDVLKKSTNCF
VVADTKTMDTGAFEGEIVLSAGADAYTVLGLADDSTIRESIDKAHEYNKLLIVDLINHPN
PYKRALELDRLGVDVVLYHVGIDVQRSRGLTIDQLIDEIKMLKKNINAKIAVAGGIKHGK
AKPLVDAGADIVVVGSAITKADDPVESAKRFMEEILS
NT seq 654 nt NT seq  +upstreamnt  +downstreamnt
gtgaaacctattcttcaggttgctctggatgttgatgacttgtttaaagcattaagctta
tctacacgtatagttgctgagcttggatgtgggaatatatggatggaagcagggactccg
ctcataaaggcttggggcaggataggagttgatgttttaaagaaatccactaattgcttc
gttgtagctgatactaagactatggataccggggcgtttgagggtgaaatagttttgagt
gctggtgctgatgcatacactgttctcggcttagctgatgactcaacaataagggaatcc
atagataaggcacatgaatataataagcttttaattgtggacttgataaatcatcctaac
ccatataaaagagctctagaacttgacaggctcggtgtagacgtagtattatatcatgtt
ggaatagatgttcagcgtagtagaggattaacaatagatcaactaatagatgagatcaaa
atgttaaagaagaatataaatgctaaaatagctgttgccggaggaataaagcatggtaaa
gcaaaaccattagttgatgctggtgcggatatagttgttgttggtagtgctataactaag
gcagatgaccccgtagagtctgctaagaggttcatggaagaaatactatcttga

DBGET integrated database retrieval system