KEGG   Stenotrophomonas maltophilia R551-3: Smal_0125Help
Entry
Smal_0125         CDS       T00733                                 

Definition
(GenBank) superoxide dismutase copper/zinc binding
  KO
K04565  superoxide dismutase, Cu-Zn family [EC:1.15.1.1]
Organism
smt  Stenotrophomonas maltophilia R551-3
Brite
Enzymes [BR:smt01000]
 1. Oxidoreductases
  1.15  Acting on superoxide as acceptor
   1.15.1  Acting on superoxide as acceptor (only sub-subclass identified to date)
    1.15.1.1  superoxide dismutase
     Smal_0125
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Sod_Cu Glyco_hydro_81 CHRD LPAM_1
Motif
Other DBs
NCBI-ProteinID: ACF49830
UniProt: B4SRW0
LinkDB All DBs
Position
165442..166062
Genome map
AA seq 206 aa AA seqDB search
MRLIHTSLFAAIAALGLAACNQQPAAPQTETPPAAPAEGATTEPAAAPAAAPAADASATA
ELAPTQGNETKGSVTFKVVDGKVHVTGQISGLKPGSEHGFHIHEKGDCSAPDGMSAGGHF
NPGKQDHGSMAVDPHHGGDMPNIKADDKGVATIDGPVSSNVNIGKGDDFDIIGRGLIVHA
DADDYKTQPTGNAGARLACAVIQKAP
NT seq 621 nt NT seq  +upstreamnt  +downstreamnt
atgcgtctgatccacacttcgctgttcgcggccattgccgcactgggcctggcggcctgc
aaccagcagcccgccgcgccgcagactgaaaccccgccggccgccccggccgagggcgct
accaccgaaccggccgcagcgccggcagcagctccggctgccgatgcctcggccactgcc
gaactggcaccgacgcagggcaatgagaccaagggcagcgtcaccttcaaggtggtcgac
ggcaaggtccacgtgactggccagatcagcggcctgaagccgggcagcgagcacggtttc
cacatccacgagaagggcgactgcagcgcgccggacggcatgagcgccggtggccacttc
aacccgggcaagcaggaccacggcagcatggccgtcgatccgcaccacggcggcgacatg
cccaacatcaaggccgacgacaagggcgtggccaccatcgatggcccggtgtcgagcaat
gtcaacatcggcaagggcgatgacttcgacatcatcggccgcggcctgatcgtccacgcc
gacgcggacgactacaagacccagccgaccggcaatgccggtgcacgcctggcgtgtgcg
gtgatccagaaggccccgtaa

DBGET integrated database retrieval system