KEGG   Stenotrophomonas maltophilia R551-3: Smal_0604Help
Entry
Smal_0604         CDS       T00733                                 

Definition
(GenBank) D-alanine/D-alanine ligase
  KO
K01921  D-alanine-D-alanine ligase [EC:6.3.2.4]
Organism
smt  Stenotrophomonas maltophilia R551-3
Pathway
smt00473  D-Alanine metabolism
smt00550  Peptidoglycan biosynthesis
smt01100  Metabolic pathways
smt01502  Vancomycin resistance
Brite
KEGG Orthology (KO) [BR:smt00001]
 09100 Metabolism
  09106 Metabolism of other amino acids
   00473 D-Alanine metabolism
    Smal_0604
  09107 Glycan biosynthesis and metabolism
   00550 Peptidoglycan biosynthesis
    Smal_0604
 09160 Human Diseases
  09175 Drug resistance: antimicrobial
   01502 Vancomycin resistance
    Smal_0604
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01011 Peptidoglycan biosynthesis and degradation proteins [BR:smt01011]
    Smal_0604
Enzymes [BR:smt01000]
 6. Ligases
  6.3  Forming carbon-nitrogen bonds
   6.3.2  Acid-D-amino-acid ligases (peptide synthases)
    6.3.2.4  D-alanine---D-alanine ligase
     Smal_0604
Peptidoglycan biosynthesis and degradation proteins [BR:smt01011]
 Precursor biosynthesis
  Amino acid ligase
   Smal_0604
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Dala_Dala_lig_C Dala_Dala_lig_N CPSase_L_D2 ATP-grasp ATP-grasp_4
Motif
Other DBs
NCBI-ProteinID: ACF50309
UniProt: B4SJX7
LinkDB All DBs
Position
715431..716393
Genome map
AA seq 320 aa AA seqDB search
MSALTFPPLRVTDPAVFGRVAVLLGGSSSEREVSLDSGRNVLEALQSRGVDAFAVDGIPA
LAKALAAGGIDRVFNILHGHNGGGEDGIVQGLMDAFGVPYTGSNVLGSALSMDKIRTKQV
WLSLGLPTPQYRKVTAEDVHANAAALGLPVVVKPANEGSSVGISRVTDDAGLDEAVALAA
RYDGQLLMEQMVIGDELTVAILGDVALPSIRIVPKGQWYDYNAKYIAEDTQYLCPGLDGD
AEDEIRRIALAAFRAAGCRGWGRVDVMRDRDSGRFFLLEVNTAPGMTSHSLVPKAARQAG
IGFEELVWRVLEQTLEASHA
NT seq 963 nt NT seq  +upstreamnt  +downstreamnt
gtgagcgcgctgaccttcccgccgctgcgagtgaccgacccggccgtgttcggccgcgtc
gccgtgctgctgggcggcagctccagcgaacgcgaggtgtcgctggactccggccgcaac
gtgctcgaagccctgcagtcgcgtggcgtcgatgcgttcgccgtggacggcatcccggcg
ctggccaaggcgctcgccgccggtggcatcgatcgcgtgttcaacatcctgcacggccac
aacggtggcggtgaggacggcatcgtgcagggcctgatggacgccttcggcgtgccgtat
accggctcgaacgtgctgggttcggcgctgagcatggacaagatccgcaccaagcaggtg
tggctgtcgctgggcctgccgaccccgcagtaccgcaaggtcactgccgaggacgtgcac
gccaatgccgccgcgctgggcttgccggtggtggtgaagccggccaacgaaggctccagc
gtgggcatcagccgggtcaccgatgacgccggcctggacgaagcggtggccctggccgcg
cgctacgacggccagctgctgatggaacagatggtgatcggcgacgaactgaccgtggcc
atcctcggcgatgtcgcgctgccgtcgatccgcatcgtgcccaagggccagtggtacgac
tacaacgccaagtacatcgccgaagacacccagtacctgtgcccgggcctggacggggat
gccgaagatgaaatccgccgcattgcgctggctgcattccgtgctgccggctgccgtggc
tggggccgcgtggacgtgatgcgcgaccgcgacagcggccgcttcttcctgctggaagtg
aacaccgcgccgggcatgaccagccattcgctggtgcccaaggccgcacgccaggccggc
atcggtttcgaggaactggtgtggcgcgtgctggaacagaccctggaggcatcgcacgca
tga

DBGET integrated database retrieval system