KEGG   Stenotrophomonas maltophilia R551-3: Smal_0688Help
Entry
Smal_0688         CDS       T00733                                 

Definition
(GenBank) alkyl hydroperoxide reductase, F subunit
  KO
K03387  NADH-dependent peroxiredoxin subunit F [EC:1.8.1.-]
Organism
smt  Stenotrophomonas maltophilia R551-3
Brite
KEGG Orthology (KO) [BR:smt00001]
 09190 Not Included in Pathway or Brite
  09191 Unclassified: metabolism
   99980 Enzymes with EC numbers
    Smal_0688
Enzymes [BR:smt01000]
 1. Oxidoreductases
  1.8  Acting on a sulfur group of donors
   1.8.1  With NAD+ or NADP+ as acceptor
    1.8.1.-  
     Smal_0688
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Pyr_redox_2 Pyr_redox_3 Pyr_redox GIDA Thioredoxin_3 FAD_binding_2 FAD_oxidored HI0933_like DAO Glutaredoxin AlaDh_PNT_C FAD_binding_3 K_oxygenase Thi4 Thioredoxin_4 FMO-like dsrm NAD_binding_8
Motif
Other DBs
NCBI-ProteinID: ACF50393
UniProt: B4SKP5
LinkDB All DBs
Position
complement(805842..807434)
Genome map
AA seq 530 aa AA seqDB search
MLDANLQSQLKTYLERVTRPIQITAHADDGAKSQEMLELLQTLDSLSDKITLQVLRDGQG
RVPSFDLGTPGQDIHLTFAGLPMGHEFTSLVLALLQVGGHPSKATAELIEQVQNLEGEYK
FETYFSLSCQNCPDVVQALNLAAVLNPRIQHVAIDGALFQDEVEKREIMSVPTVYLNGEV
FDQGRMTLEQIVAKLDTNASKRDAEKIAAKDAFDVLVVGGGPAGAAAAIYAARKGIRTGI
AAERFGGQVLDTMAIENFISVKETEGPKLATALEQHVREYEVDIMDLQRASALVPAGEDG
LVQVQLENGAVLKSRSVILSTGARWRQMNVPGEDQYRNKGVAYCPHCDGPLFKGKRVAVI
GGGNSGVEAAIDLAGIVSHVTLLEFDSSLRADEVLQKKLRSLANVTVLTSAQTTEVLGDG
SRVTGLVYKDRVGGDAHRVELEGIFVQIGLLPNTEWLKDTVALSPRGEVVIDDRGQTNLP
GVFAAGDCTTVPYKQIIIAMGAGSTAALSAFDHLIRSSVSSSSGAVAEAA
NT seq 1593 nt NT seq  +upstreamnt  +downstreamnt
atgttggacgccaacctgcagtcgcagctgaagacctatctggagcgcgtgacccgcccg
atccagatcaccgcgcacgccgacgacggcgccaagtcgcaggaaatgctggaactgctg
cagaccctggacagcctgtcggacaagatcacgctgcaggtcctgcgcgatggccagggc
cgcgtgccgtccttcgacctgggtaccccgggccaggatatccacctgaccttcgccggc
ctgccgatgggccacgagttcacctcgctggtgctggcgctactgcaggtgggcggtcat
ccgtccaaggccaccgccgagctgatcgagcaggtgcagaacctggaaggcgaatacaag
ttcgaaacctacttctcgctttcctgccagaactgcccggacgtggtgcaggcgctgaac
ctggccgcggtgctcaacccgcgcatccagcacgtggccatcgacggtgccctgttccag
gacgaagtcgagaagcgcgagatcatgtcggtgccgaccgtgtacctcaacggtgaagtg
ttcgaccagggccgcatgaccctcgagcagatcgtggccaagctggataccaatgccagc
aagcgcgatgccgagaagatcgccgccaaggacgccttcgacgtgctggtggtgggcggt
ggcccggccggcgcggcagcagcgatctacgctgcacgcaagggtatccgcaccggcatc
gccgccgagcgtttcggtggccaggtgctggacacgatggcgatcgagaacttcatttcg
gtgaaggagaccgaaggcccgaagctggccacggcgctggaacagcacgtgcgcgagtac
gaggtggacatcatggacctgcagcgcgccagcgcgctggtgccggccggtgaagacggc
ctggtgcaggtgcagctggagaacggcgcggtactgaagtcgcgctcggtgatcctgtcc
accggcgcgcgctggcggcagatgaatgtgccgggcgaagaccagtaccgcaacaagggc
gtggcctactgcccgcactgcgatggtccgctgttcaagggcaagcgcgtggcggtgatc
ggcggcggcaactccggcgtggaagcggccatcgatctggccggcatcgtgtcgcatgta
accctgctggagttcgattccagcctgcgcgccgacgaagtgctgcagaagaagctgcgc
agcctggccaacgtcaccgtgctgaccagcgcacagaccaccgaagtgctgggcgacggc
agccgtgtcaccggcctggtctacaaggaccgtgtcggcggcgacgcccaccgcgtcgag
ctggaaggcatcttcgtgcagatcggcctgctgcccaacaccgagtggctgaaggacacc
gtggcgctgtcgccgcgtggcgaggtcgtcatcgatgaccgcggccagaccaacctgccg
ggcgtgttcgctgctggcgattgcacgacggtaccctacaagcagatcatcattgccatg
ggtgccggttcgaccgccgcattgagtgcgttcgaccacctgatccgctcgtcggtgagc
agcagcagtggtgctgttgctgaagctgcctga

DBGET integrated database retrieval system