KEGG   Stenotrophomonas maltophilia R551-3: Smal_0875Help
Entry
Smal_0875         CDS       T00733                                 

Definition
(GenBank) para-aminobenzoate synthase component I
  KO
K01657  anthranilate synthase component I [EC:4.1.3.27]
Organism
smt  Stenotrophomonas maltophilia R551-3
Pathway
smt00400  Phenylalanine, tyrosine and tryptophan biosynthesis
smt01100  Metabolic pathways
smt01110  Biosynthesis of secondary metabolites
smt01130  Biosynthesis of antibiotics
smt01230  Biosynthesis of amino acids
smt02024  Quorum sensing
Module
smt_M00023  Tryptophan biosynthesis, chorismate => tryptophan
Brite
KEGG Orthology (KO) [BR:smt00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00400 Phenylalanine, tyrosine and tryptophan biosynthesis
    Smal_0875
  09110 Biosynthesis of other secondary metabolites
   00405 Phenazine biosynthesis
    Smal_0875
 09140 Cellular Processes
  09145 Cellular community - prokaryotes
   02024 Quorum sensing
    Smal_0875
Enzymes [BR:smt01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.3  Oxo-acid-lyases
    4.1.3.27  anthranilate synthase
     Smal_0875
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Chorismate_bind Anth_synt_I_N Zfx_Zfy_act
Motif
Other DBs
NCBI-ProteinID: ACF50580
UniProt: B4SMA3
LinkDB All DBs
Structure
PDB: 

Position
1021900..1023264
Genome map
AA seq 454 aa AA seqDB search
MTHAPLIHPLPHPIDLLALQQHDPARFPLLMESTASGTAQGRWSLLLAAQGDCLRLDADG
RVRDQRDVVQAGSFLQVLDRAWQRERLPHDGSHSLPFRGGWALMLDYEVASQIETVLPSR
ARDDGRPTALALRCPAAVLHDHHNDASFVIAEAGEHALLDALVALASAVLPEAGQGWLPP
QSVGEDAPQRFTDGVRRVIEYLRAGDVFQVNLSRRWSAQFAAPVSPQALYAQLRRANPAP
FAGLFTAHGRHVVSSSPERLVSVHAGHAQTRPIAGTRPRFEGDDDAARIQELVGHPKERA
EHVMLIDLERNDLGRICLPGTVVVDELMTVESYAHVHHIVSNVSGHLRPDVTPGEVIAAT
FPGGTITGCPKVRCMQIISELEQVPRGAYTGAFGWLNRDGDLDLNILIRTAEVDGHEVSF
RTGAGIVVDSDPDKELDETRAKARGLLRALGQQG
NT seq 1365 nt NT seq  +upstreamnt  +downstreamnt
atgacccacgccccgctgatccacccgctgccgcacccgatcgacctgctggccctgcag
cagcacgacccggcgcgcttcccgctgctgatggaatccactgcctcgggcaccgcccag
ggccgctggagcctgctgctggccgcgcagggcgattgcctgcggctggatgccgatggc
cgggtgcgtgaccagcgcgacgtggtgcaggccggcagcttcctgcaggtgctggaccgt
gcctggcagcgcgaacgcctgccgcatgacggcagccacagcctgccgttccgcggcggt
tgggcgttgatgctggattacgaagtggccagccagatcgaaaccgtgctgccgtcgcgt
gcgcgcgatgacggtcgcccgaccgcgctggcgctgcgctgcccggcggcggtgctgcac
gatcaccacaacgacgccagcttcgtcatcgccgaagccggtgagcatgcgctgctggat
gcgttggtggcactggcctcggccgtgctgcccgaagcagggcagggctggttgccgccg
cagtcggtcggcgaggacgcgccgcagcgcttcaccgacggcgtgcgccgggtgatcgag
tacctgcgcgccggcgacgtgttccaggtgaacctgtcgcggcgctggagcgcacagttc
gccgcgccggtcagtccccaggcgctgtacgcgcagctgcgccgcgccaacccggccccg
ttcgccggcctgttcaccgcgcacggccgccacgtggtcagttcctcgccggaacggctg
gtgtcggtgcacgccggccatgcgcagacccggccgattgccggcacccgcccgcgcttc
gaaggcgatgacgatgccgcgcgcatccaggagctggtcggccacccgaaggagcgtgcc
gagcacgtgatgctgatcgacctggagcgcaacgacctgggccgcatctgcctgcctggt
accgtggtggtcgatgaactgatgaccgtggaaagttacgcccacgtgcaccacatcgtc
agcaatgtcagtggccatctgcgtccagacgtgaccccgggtgaagtgatcgccgccacc
ttccccggcggcaccatcaccggctgcccgaaggtgcgctgtatgcagatcatcagcgaa
ctggagcaggtgccgcgcggtgcctacaccggcgccttcggttggctgaaccgcgatggc
gacctggacctgaacatcctgatccgcaccgccgaagtggacggccacgaggtgagcttc
cgcaccggcgccggcatcgtggtcgactcggacccggacaaggaactggacgagacccgc
gccaaggcccgcggcctgctgcgcgcgctcggccagcaggggtag

DBGET integrated database retrieval system