KEGG   Stenotrophomonas maltophilia R551-3: Smal_1322
Entry
Smal_1322         CDS       T00733                                 

Definition
(GenBank) putative RNA methylase
  KO
K12297  23S rRNA (guanine2445-N2)-methyltransferase / 23S rRNA (guanine2069-N7)-methyltransferase [EC:2.1.1.173 2.1.1.264]
Organism
smt  Stenotrophomonas maltophilia R551-3
Brite
KEGG Orthology (KO) [BR:smt00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03009 Ribosome biogenesis [BR:smt03009]
    Smal_1322
Enzymes [BR:smt01000]
 2. Transferases
  2.1  Transferring one-carbon groups
   2.1.1  Methyltransferases
    2.1.1.173  23S rRNA (guanine2445-N2)-methyltransferase
     Smal_1322
    2.1.1.264  23S rRNA (guanine2069-N7)-methyltransferase
     Smal_1322
Ribosome biogenesis [BR:smt03009]
 Prokaryotic type
  rRNA modification factors
   23S rRNA modification factors
    Smal_1322
SSDB
Motif
Pfam: UPF0020 Methyltrans_SAM MTS Methyltransf_25 Cons_hypoth95 THUMP Methyltransf_31 Methyltransf_11 PrmA Methyltransf_15 Methyltransf_24 N6_Mtase
Other DBs
NCBI-ProteinID: ACF51027
UniProt: B4SQ79
LinkDB
Position
1506880..1509018
AA seq 712 aa
MKFFVSCAKGLEYLLADELSALGLEKATATIAGVNAEGELEQALRIVMWSRLASRVLWPI
DAFECPDEQALYDGVRALPWHEHIKPEMTLAVDAHVSGDKITHARFAAQRIKDAIVDRMR
DEGLERPSVNTDLPDVRVNLSLRKGRASLSIDLGGGSLHRRGWRGAAHEAPLKENLAAAL
LLRAQWPRLHAAGGGLLDPMCGSGTLLIEGALMAADVAPGLMRHGSLPPSRWLGFDKAAW
KAIQSEARDREAAGLAALKPVIHGSDIDPTAIQAARENAEVAGVAHAIRFTRADVADLAA
PEQEIGAVVCNPPYDERLAADPALYRALGNALQKAVPQWRASLLCGNDELAFATGLRAGK
KYQMFNGALECALIICDPIAVPGRDPAQPRELSEGAQMVANRLRKNLKKFKSWRAREDIT
CFRAYDADLPEYAAAIDVYEEDGGQRRTFLHVQEYAAPAAIPENDVRRRRNELLAAAREV
FGVPPEQVSMKSRERGKGGSKYGRFEQRDEFIVVRENNALLQVNLFDYLDTGLFLDHRPL
RRMMAEQALGKRFLNLFCYTGVASVQAAVAGAASTTSVDLSATYLQWCYDNLALNGQGGN
QHLLVQADAMAWLEGDRGQYDVIFCDPPTFSNSARADDFDVQREQLKLLRAAVARLAPGG
VLYFSNNFRRFKLEENAIAEFAQCREITARTIGPDFERNARIHRAWELKRLG
NT seq 2139 nt   +upstreamnt  +downstreamnt
gtgaaattttttgtctcctgcgccaagggcctggaatacctgcttgccgatgagctgtcg
gccctgggcctggaaaaggccactgccaccattgccggcgtcaacgccgagggcgaactg
gagcaggcgctgcggatcgtgatgtggtcgcgcctggccagccgcgtgctgtggcccatc
gacgcgttcgagtgcccggacgagcaggccctgtacgacggcgtgcgcgccctgccgtgg
cacgagcacatcaagccggaaatgaccctggcggtggatgcgcacgtgtccggcgacaag
atcacccatgcgcgcttcgccgcgcagcggatcaaggacgccattgtcgaccgcatgcgt
gacgaaggcctggaacgcccctcggtcaacaccgatctgcccgacgtgcgcgtgaacctg
tcactgcgcaagggccgtgcctcgctgtcgatcgacctcggcggcggctcgctgcaccgc
cgtggctggcgaggcgccgcccacgaggcgccgctgaaggaaaacctcgccgccgccctg
ctgctgcgcgcgcagtggccgcgcctgcacgccgccggtggtggcctgctggacccgatg
tgcggcagtggcacgctgctgatcgaaggtgcgctgatggccgccgacgtcgcccccggc
ctgatgcgccacggcagcctgccgccgagccgctggctgggtttcgacaaggccgcctgg
aaggcgatccagagcgaggcacgtgaccgcgaagctgctggcctggctgcgctgaagccg
gtcatccacggcagcgacatcgacccgaccgcaatccaggccgcgcgcgaaaatgctgaa
gtggccggcgtcgcccatgcgatccgtttcacccgcgccgatgtggccgacctggctgcg
ccggagcaggaaatcggtgcggtggtctgcaatccgccgtacgacgagcgcctggccgcc
gatccggcgctgtaccgtgcgctgggcaacgcgctgcagaaggcggtgccgcagtggcgt
gcgagcctgctgtgcggcaacgacgagctggcctttgccactggcctgcgtgcgggtaag
aagtaccagatgttcaacggtgcgctggaatgcgcgctgatcatctgcgacccgatcgcc
gtgcccggacgcgacccggctcagccgcgtgagctgagcgaaggcgcgcagatggtggcc
aaccgcctgcgcaagaacctgaagaagttcaagagctggcgcgcccgagaggacatcacc
tgcttccgcgcctatgacgccgacctgccggaatacgcggcggccattgatgtctacgag
gaagacggtggccagcgccgtaccttcctgcacgtgcaggaatatgccgcgccggccgcg
attccggaaaacgacgtgcgtcgtcgccgcaacgaactgttggccgctgcacgggaagtg
ttcggcgtgccgccggagcaggtgtcgatgaagtcgcgtgagcgcggcaagggcggcagc
aagtacggccgtttcgaacagcgtgatgaattcatcgtggtgcgtgagaacaatgcgctg
ctgcaggtgaacctgttcgactaccttgacaccggcttgttcctcgaccaccgcccgctg
cgccggatgatggccgagcaggcgcttggcaagcgcttcctcaacctgttctgctacacc
ggcgtggccagcgtgcaggccgccgtggccggtgcggccagcaccaccagcgtcgacttg
tcggcgacttacctgcagtggtgctacgacaacctggcgctgaacgggcagggcggcaac
cagcacctgctggtgcaggccgatgcgatggcctggctggaaggcgaccgcggccagtac
gacgtgatcttctgcgatccgccgacgttctccaactccgcgcgtgccgacgacttcgac
gtgcagcgcgagcagctgaaactgctgcgtgcagcggtggcgcggctggcgccaggtggc
gtgctgtacttctccaacaacttccgccgcttcaagctggaagagaacgccatcgccgaa
ttcgcccagtgccgcgagatcaccgcgcgcaccatcggcccggatttcgagcgcaacgcg
cgcatccaccgtgcgtgggaactgaagcggttggggtaa

DBGET integrated database retrieval system