KEGG   Stenotrophomonas maltophilia R551-3: Smal_2960Help
Entry
Smal_2960         CDS       T00733                                 

Definition
(GenBank) ATP dependent DNA ligase
  KO
K10747  DNA ligase 1 [EC:6.5.1.1 6.5.1.6 6.5.1.7]
Organism
smt  Stenotrophomonas maltophilia R551-3
Pathway
smt03030  DNA replication
smt03410  Base excision repair
smt03420  Nucleotide excision repair
smt03430  Mismatch repair
Brite
KEGG Orthology (KO) [BR:smt00001]
 09120 Genetic Information Processing
  09124 Replication and repair
   03030 DNA replication
    Smal_2960
   03410 Base excision repair
    Smal_2960
   03420 Nucleotide excision repair
    Smal_2960
   03430 Mismatch repair
    Smal_2960
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03032 DNA replication proteins [BR:smt03032]
    Smal_2960
   03400 DNA repair and recombination proteins [BR:smt03400]
    Smal_2960
Enzymes [BR:smt01000]
 6. Ligases
  6.5  Forming phosphoric-ester bonds
   6.5.1  Ligases that form phosphoric-ester bonds (only sub-subclass identified to date)
    6.5.1.1  DNA ligase (ATP)
     Smal_2960
    6.5.1.6  DNA ligase (ATP or NAD+)
     Smal_2960
    6.5.1.7  DNA ligase (ATP, ADP or GTP)
     Smal_2960
DNA replication proteins [BR:smt03032]
 Eukaryotic Type
  DNA Replication Elongation Factors
   Other elongation factors
    Smal_2960
 Prokaryotic Type
   Elongation factors (archaeal)
    Other elongation factors
     Smal_2960
DNA repair and recombination proteins [BR:smt03400]
 Eukaryotic Type
  SSBR (single strand breaks repair)
   BER (base exicision repair)
    Long Patch-BER factors
     Smal_2960
   NER (nucleotide excision repair)
    Other NER factors
     Smal_2960
   MMR (mismatch exicision repair)
    Other MMR factors
     Smal_2960
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: DNA_ligase_A_M DNA_ligase_A_N DNA_ligase_A_C LPD22
Motif
Other DBs
NCBI-ProteinID: ACF52659
UniProt: B4SRJ5
LinkDB All DBs
Position
3297825..3299432
Genome map
AA seq 535 aa AA seqDB search
MKAFAALYQRLDRSTATLDKRAALVDYFRHARAHDAAWALYLLSGGKVGGARRKIAASGE
LRAWIAEESALPPWLVEDSYAQVGDLAETLTLLLDDPAQPSLDRPLAEWIEQHLLAVANQ
PEPVRREAVVSGWQQLCSRERLVFNKLLTGALRVGVSQRLVQQALAEWSGLDIARIAQRM
LGDWVPSPGLLGQLLSPDELPLDRQQPYPFFLASPLEGAPGDRLGPVDDWLLEWKWDGIR
LQLLRRRGEVALWSRGEERLDGRFPEIEQAAMGLPDGCVLDGELLAWDEATGLPRAFTAL
QTRIQRRKPGAATLRNTPVRVLAYDLLEQEGADLRGLPLQQRRMRLAEVIGALGDTRIQL
SPEVPADDWSQAAALREAARERGVEGLMVKRRASAYQSGRRRGDWWKWKVDPLTIDAVLL
YAQAGHGRRSTLYTDYTFGIWDGDTLVPVAKAYSGLDDKEILALDRWIRANTRERFGPVR
SVRAEQVFELGFEAVNRSSRHKSGIAVRFPRILRWRHDKPASEADQLATLQALAR
NT seq 1608 nt NT seq  +upstreamnt  +downstreamnt
atgaaggccttcgccgcgctctaccagcgcctggaccgcagcaccgcgacactggacaag
cgtgcggcgctggtcgactacttccgccacgcgcgtgcgcatgatgcggcgtgggcgctg
tacctgctcagcggcggcaaagtgggcggtgcacgccggaagatcgccgccagtggcgaa
ctgcgcgcctggattgccgaagaatcagcgctgccaccgtggctggtcgaagacagctat
gcccaggtcggagacctggccgagacactgaccctgctgctggatgatccagcgcagcct
tcgctcgaccggccattggccgaatggatcgaacagcacctgctggccgtggccaaccag
cccgaaccggtacgccgcgaggcggtggtctcgggctggcagcagctgtgcagccgcgaa
cgcctggtgttcaacaaactgctgaccggcgccctgcgcgtgggtgtttcgcagcgtctg
gtgcagcaggcgctggccgaatggtccggcctggacatcgcgcgcatcgcccagcgcatg
ctcggcgactgggtgccctcacccgggctgctgggccagctgttgtcgccggacgagctg
ccactggaccggcaacagccctacccgttcttcctcgcctcgccactggaaggcgctccc
ggcgatcgcctcggtcccgtcgacgactggctgctggaatggaaatgggatggcatccgc
ctgcaactgctgcgccggcgtggcgaagtggcactgtggtcacgcggcgaggaacgcctg
gacggccgcttccccgagatcgaacaggcggcgatgggcctccccgatggctgcgtgctg
gacggcgagctgctggcctgggatgaggccaccggcctgccgcgcgccttcaccgcgctg
cagacccgcatccaacggcgcaagcccggtgcggcgacgttgcgcaacacaccggtacgg
gtgctggcctacgacctgcttgaacaggagggcgcggatctgcgcggactgccgttgcag
caacggcgcatgcgcctcgccgaagtcatcggcgcactgggcgacacgcgtatccagctc
tcgcccgaagttcccgccgatgactggtcgcaggctgcagcactgcgggaagcagcacgc
gagcgtggtgtcgaaggattgatggtgaagcggcgcgcatcggcttaccagtccggacga
cgacgtggcgactggtggaaatggaaagtcgatccactcaccatcgatgccgtgctgttg
tacgcgcaggcgggacacgggcggcgcagcacgctgtacaccgactacactttcgggatc
tgggacggcgacacgctggtgccagtagccaaggcttactcgggtctggacgacaaggag
atccttgccctcgatcgctggatccgcgccaacacgcgtgagcgcttcgggcctgtacgc
agcgtgcgcgccgaacaggtattcgaactcggattcgaagcggtcaaccgcagcagccgg
cacaagtccggcatcgccgtgcgttttccgcgcatcctgcgctggcggcacgacaaaccg
gccagtgaggccgaccagctggccaccctgcaggcgctggcacgatga

DBGET integrated database retrieval system