KEGG   Stenotrophomonas maltophilia R551-3: Smal_3095Help
Entry
Smal_3095         CDS       T00733                                 

Definition
(GenBank) penicillin-binding protein 1B
  KO
K05365  penicillin-binding protein 1B [EC:2.4.1.129 3.4.16.4]
Organism
smt  Stenotrophomonas maltophilia R551-3
Pathway
smt00550  Peptidoglycan biosynthesis
Brite
KEGG Orthology (KO) [BR:smt00001]
 09100 Metabolism
  09107 Glycan biosynthesis and metabolism
   00550 Peptidoglycan biosynthesis
    Smal_3095
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01003 Glycosyltransferases [BR:smt01003]
    Smal_3095
   01011 Peptidoglycan biosynthesis and degradation proteins [BR:smt01011]
    Smal_3095
Enzymes [BR:smt01000]
 2. Transferases
  2.4  Glycosyltransferases
   2.4.1  Hexosyltransferases
    2.4.1.129  peptidoglycan glycosyltransferase
     Smal_3095
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.16  Serine-type carboxypeptidases
    3.4.16.4  serine-type D-Ala-D-Ala carboxypeptidase
     Smal_3095
Glycosyltransferases [BR:smt01003]
 Polysaccharide
  Bacterial polysaccharide
   Smal_3095
Peptidoglycan biosynthesis and degradation proteins [BR:smt01011]
 Peptidoglycan biosynthesis and degradation
  Glycosyltransferase/DD-Transpeptidase (Class A PBP)
   Smal_3095
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Transgly Transpeptidase UB2H
Motif
Other DBs
NCBI-ProteinID: ACF52794
UniProt: B4ST03
LinkDB All DBs
Position
complement(3459269..3461710)
Genome map
AA seq 813 aa AA seqDB search
MPRRYDSDDIDDFDDDDQQDNSPLWRRRLITWSMAAVALGLGFLIPYTLYLNQQVTQRFG
ELRWQIPTRVYARPLVLTPGKAMDASTLKTELAASAYRDDGQGKEPATYAVNGGRFVISS
RGYNDVDGVVAARRVELSLADGGIASLRDAGSRKALKAARLDPARIATLYGQKQEERRLI
RMDEAPDLLVTGLQAVEDKDFNRHHGIDLSGIARAVWVTIRSGGQSRQGASTLTQQLARS
GLLGIGKEQTVTRKFNEVLYALIMEARYDKRTIFEAYLNQVYLGQRGSQAIHGMSSGAEF
WFGRDLSSLETEQIALLIGLVKGPSFYDPRRNPERALDRRNFVLGKLHEATLIDDAEYQR
ALKAPLGVPKTPGLVAANRFPAYVDLVRRQLGHDYPESALQGAGLSVMSGMSPSAQAYAE
GAVTRTIKSLESKRRPELQAGMVLTDVHNGDVLAVIGSREVSEVGFNRAIEAQRPVGSLL
KPFVYLLALAQPDRYSLASWVDDSPVTVQLGRGRNWNPGNADNRSHGTVRLIDALAHSYN
QATVRVGMQVGPERVTQLIHVLAGIKAEANPAVILGSTDQSPYAMAQLYQFLASGGEIQP
LHAVRGVLDPQGKLLKRYDKTPAPAQEGDSIAANLISVGLQQVVASGTAQRLNADGLGRL
QPAGKTGTTNDGRDSWYAGYTGDHLAVIWMGNDQNEQAGLYGATGAMRVWSGIFQRLPSA
PLRVSNKGLDWQSVAATGMNTTDDGCPGARRFPFVVGYAPAYAPCAPAVSPDGQGGAEGE
GGGWRSWFGLDRKPEPPAEPAAAPAAATPPPSR
NT seq 2442 nt NT seq  +upstreamnt  +downstreamnt
gtgccccgacgctacgattccgacgacatcgacgatttcgacgacgacgaccagcaggac
aacagccccctgtggcggcgccgcctgatcacctggagcatggcagcggtcgcgttggga
ttgggtttcctgattccctatacgctgtacctgaaccagcaggtgacccagcgcttcggc
gaactgcgctggcagatcccgacgcgggtctatgcacgcccgctggtgctcacgcccggc
aaggcgatggacgcgtccaccctgaagaccgagctggccgcctccgcctaccgcgatgac
gggcagggcaaggagccggcgacctacgccgtgaacggcggccgtttcgtcatctccagc
cgtggctacaacgacgtggatggcgtggtcgccgcgcgtcgtgtcgagctgtcgctggcc
gatggaggcatcgcctcgctgcgtgacgctggcagtcgcaaggcactgaaggccgcgcgg
ctggatccggcgcgtatcgccaccctgtacgggcagaagcaggaagagcgccgcctgatc
cgcatggatgaggcacctgacctgctggtgaccggcctgcaggcggtggaggacaaggac
ttcaaccgccatcacggcatcgatctgtccggcatcgcgcgtgcggtgtgggtgacgatt
cgttccggcggccagagccgccagggtgcttccaccctgacccagcagctggcccgcagc
ggcctgctcggtattggcaaggaacagacggtcacccgcaagttcaatgaagtgctctac
gcgctgatcatggaagcgcgctacgacaagcgcaccatcttcgaggcctacctcaaccag
gtgtacctgggccagcgcggcagccaggccatccacggcatgtcctccggtgccgaattc
tggttcggccgcgacctgtcgtcgctggaaaccgagcagatcgcgttgctgatcggcctg
gtcaagggcccctccttctacgatccgcgtcgcaacccggaacgcgcgctggatcgccgc
aacttcgtgctgggcaagctgcacgaggcaaccctgatcgacgatgccgagtaccagcgc
gccctcaaggcgccgctcggcgtgcccaagaccccgggcctggtcgctgccaaccgcttc
ccggcctacgtcgatctggtccgtcgccagcttggccatgactatccggaatcggcactg
cagggcgcgggcctgagcgtgatgagcggcatgtcgccgtccgcccaggcctatgccgaa
ggcgcggtcacccgcaccatcaagtcgctggagagcaagcgccggccggagctgcaggcc
ggcatggtgctgaccgatgtgcacaacggcgacgtgctggcggtgatcggcagccgcgag
gtctccgaagtcggcttcaaccgcgccatcgaggcacagcgcccggtcggctcgctgctc
aagccgttcgtgtacctgctggcgctggcacagccggaccgctactcgctggccagctgg
gtcgacgattcaccggtgaccgtgcagctcggccgcggccgcaactggaatcccggcaat
gccgacaaccgcagccacggcacggtgcgcctgatcgacgcgctggcgcattcctacaat
caggccacggtgcgcgtgggcatgcaggtcggccccgagcgcgtgacccagctgatccac
gtgctggccgggatcaaggccgaggcgaatccggcggtgatcctcggttcgaccgaccag
agcccctacgcgatggcgcagctgtaccagttcctggcttcgggtggcgagatccaaccg
ttgcacgcggtgcgtggcgtgctcgatccgcagggcaagctgctcaagcgctacgacaag
accccggcgccggcgcaggaaggtgactcgatcgccgccaatctgatcagcgtcggcctg
cagcaggtggtcgccagcggcaccgcgcagcgcctgaacgccgatggcctcggccgcctg
cagccggcgggcaagaccggtaccaccaacgatggtcgcgacagttggtacgccgggtac
accggtgaccacctggcggtgatctggatgggcaacgaccagaacgagcaggccggcctg
tacggtgccaccggtgcgatgcgggtgtggtcgggcatcttccagcgcctgccgagtgcc
ccgctgcgggtcagcaacaagggcctggactggcagtcggtggccgccaccggcatgaac
actaccgacgatggttgcccgggcgcgcgtcgcttcccgttcgtagtgggttatgcaccg
gcctatgcgccgtgtgcgccggcggtgtcgccggatgggcagggtggggccgaaggtgag
ggcggcggctggcgcagctggttcggcctggaccgaaagcccgagccgcctgctgaacct
gccgcggcacccgccgcggccacacctcctccgagccgatga

DBGET integrated database retrieval system