KEGG   Streptococcus mutans UA159 (serotype c): SMU_1117
Entry
SMU_1117          CDS       T00100                                 

Gene name
naoX
Definition
(RefSeq) NADH oxidase (H2O-forming)
Organism
smu  Streptococcus mutans UA159 (serotype c)
SSDB
Motif
Pfam: Pyr_redox_2 Pyr_redox Pyr_redox_3 Pyr_redox_dim DAO HI0933_like NAD_binding_9 UDPG_MGDP_dh_N 3HCDH_N TrkA_N AlaDh_PNT_C 2-Hacid_dh_C K_oxygenase ThiF Rossmann-like Ldh_1_N GIDA DUF1188 XdhC_C
Other DBs
NCBI-GeneID: 1028431
NCBI-ProteinID: NP_721504
UniProt: I6L920
LinkDB
Position
complement(1058760..1060133)
AA seq 457 aa
MSKIVIVGANHAGTAAINTILDNYGSENEVVVFDQNSNISFLGCGMALWIGKQISGPQGL
FYADKESLEAKGAKIYMESPVTAIDYDAKRVTALVNGQEHVESYEKLILATGSTPILPPI
KGAAIKEGSRDFEATLKNLQFVKLYQNAEDVINKLQDKSQNLNRIAVVGAGYIGVELAEA
FKRLGKEVILIDVVDTCLAGYYDQDLSEMMRQNLEDHGIELAFGETVKAIEGDGKVERIV
TDKASHDVDMVILAVGFRPNTALGNAKLKTFRNGAFLVDKKQETSIPDVYAIGDCATVYD
NAINDTNYIALASNALRSGIVAGHNAAGHKLESLGVQGSNGISIFGLNMVSTGLTQEKAK
RFGYNPEVTAFTDFQKASFIEHDNYPVTLKIVYDKDSRLVLGAQMASKEDMSMGIHMFSL
AIQEKVTIERLALLDYFFLPHFNQPYNYMTKAALKAK
NT seq 1374 nt   +upstreamnt  +downstreamnt
atgagtaaaatcgttattgttggagctaaccatgcaggtacagctgccattaatactatt
ctagataattacggtagtgaaaacgaagttgtcgtttttgaccaaaattctaatatttca
ttcttgggttgtggaatggcactttggattggaaaacaaatatcaggccctcaaggtctt
ttttatgctgataaggaatcgttagaagcaaaaggtgctaaaatttatatggaatcgcca
gtgacagccattgattatgatgctaagagggttactgctttggtcaatggtcaagaacat
gttgagagctatgagaagcttattttggcaacaggatcaacaccaatcttaccacctatc
aaaggtgcagctatcaaagaaggtagtcgtgattttgaagcaactttgaaaaatcttcaa
tttgttaaattgtatcaaaatgcagaagatgttattaataaattacaggataagagtcaa
aatctgaatcgtattgctgttgttggtgctggttatattggtgtagaacttgctgaagcc
tttaaacgcctcggaaaagaagtgattcttattgatgttgttgatacttgcttagctggt
tattatgatcaggatctttcagaaatgatgcgtcaaaatttggaagatcatggtattgaa
ttagcattcggagaaactgtcaaagccattgaaggtgatggtaaagtcgagcgtattgta
actgataaagcgagtcatgatgtggatatggttattttagctgtcggtttccgtcctaat
actgcacttggcaacgctaaactcaaaaccttccgtaatggtgctttccttgttgataaa
aaacaagagacaagtattcctgacgtttatgccatcggcgattgcgcgactgtttatgac
aacgctattaatgataccaattatattgccttagcttcaaacgctcttcgctcaggtatt
gtagctggtcataatgcagcagggcataaattggaatctcttggtgttcaaggttcaaat
ggtatttcaatttttggtctcaatatggtttcaactgggttaacgcaagaaaaagcaaag
cgttttggctataatccagaagtcactgcatttacagattttcagaaggctagttttatt
gaacatgataattatcctgttacacttaaaattgtctatgataaggatagccgactggtt
cttggtgcacaaatggcatctaaagaagatatgtcaatgggaattcatatgttttcattg
gctattcaggaaaaagttaccattgaacgtttagctctactggactatttctttcttcct
catttcaatcaaccctataattatatgaccaaagcagcattaaaagctaaatga

DBGET integrated database retrieval system