KEGG   Streptococcus mutans UA159 (serotype c): SMU_130
Entry
SMU_130           CDS       T00100                                 

Gene name
adhD
Definition
(RefSeq) dihydrolipoamide dehydrogenase
  KO
K00382  dihydrolipoamide dehydrogenase [EC:1.8.1.4]
Organism
smu  Streptococcus mutans UA159 (serotype c)
Pathway
smu00010  Glycolysis / Gluconeogenesis
smu00020  Citrate cycle (TCA cycle)
smu00260  Glycine, serine and threonine metabolism
smu00280  Valine, leucine and isoleucine degradation
smu00310  Lysine degradation
smu00380  Tryptophan metabolism
smu00620  Pyruvate metabolism
smu00630  Glyoxylate and dicarboxylate metabolism
smu00640  Propanoate metabolism
smu01100  Metabolic pathways
smu01110  Biosynthesis of secondary metabolites
smu01120  Microbial metabolism in diverse environments
smu01200  Carbon metabolism
Module
smu_M00307  Pyruvate oxidation, pyruvate => acetyl-CoA
Brite
KEGG Orthology (KO) [BR:smu00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    SMU_130 (adhD)
   00020 Citrate cycle (TCA cycle)
    SMU_130 (adhD)
   00620 Pyruvate metabolism
    SMU_130 (adhD)
   00630 Glyoxylate and dicarboxylate metabolism
    SMU_130 (adhD)
   00640 Propanoate metabolism
    SMU_130 (adhD)
  09105 Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    SMU_130 (adhD)
   00280 Valine, leucine and isoleucine degradation
    SMU_130 (adhD)
   00310 Lysine degradation
    SMU_130 (adhD)
   00380 Tryptophan metabolism
    SMU_130 (adhD)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:smu04147]
    SMU_130 (adhD)
Enzymes [BR:smu01000]
 1. Oxidoreductases
  1.8  Acting on a sulfur group of donors
   1.8.1  With NAD+ or NADP+ as acceptor
    1.8.1.4  dihydrolipoyl dehydrogenase
     SMU_130 (adhD)
Exosome [BR:smu04147]
 Exosomal proteins
  Exosomal proteins of breast cancer cells
   SMU_130 (adhD)
SSDB
Motif
Pfam: Pyr_redox_2 Pyr_redox_dim Biotin_lipoyl Pyr_redox Pyr_redox_3 GIDA FAD_oxidored FAD_binding_2 NAD_binding_8 HI0933_like FAD_binding_3 Biotin_lipoyl_2 DAO 3HCDH_N Trp_halogenase Thi4 Arc_PepC Lycopene_cycl UDPG_MGDP_dh_N AlaDh_PNT_C
Other DBs
NCBI-GeneID: 1029705
NCBI-ProteinID: NP_720603
UniProt: Q8DWD4
LinkDB
Position
132644..134389
AA seq 581 aa
MAVEIIMPKLGVDMQEGEIIEWKKQEGDEVKEGDILLEIMSDKTNMEIEAEDSGVLLKIV
KGNGQVVPVTEVIGYIGSAGETIETNAAPAASADDLKAAGLEVPDTLGESAAPAAQKTPL
ADDEYDMIVVGGGPAGYYAAIRGAQLGGKVAIVEKSEFGGTCLNKGCIPTKTYLKNAEIL
DGIKIAAGRGINFASTNYTIDMDKTVAFKDTVVKTLTSGVQGLLKANKVTIFNGLGQVNP
DKTVTVGSETIKGHNIILATGSKVSRINIPGIDSPLVLTSDDILDLREIPKSLAVMGGGV
VGIELGLVYASYGTEVTVIEMADRIIPAMDKEVSLELQKILSKKGMNIKTSVGVAEIVEA
NNQLTLKLNDGSEVVAEKALLSIGRVPQLSGLENLNLELERGRIKVDDYQETSISGIYAP
GDVNGRKMLAHAAYRMGEVAAENAIWGNVRKANLKYTPAAVYTHPEVAMCGITEEQARQE
YGNVLVGKSSFSGNGRAIASNEAQGFVKVVADAKYHEILGVHIIGPAAAEMINEASTIME
NELTVDELLRSIHGHPTFSEVMYEAFADVLGEAIHNPPKRR
NT seq 1746 nt   +upstreamnt  +downstreamnt
atggcagtcgaaattattatgcctaaactcggtgttgatatgcaggaaggcgaaatcatc
gagtggaaaaaacaagaaggtgatgaggtcaaagaaggggatatcctccttgaaatcatg
tctgacaagaccaatatggaaattgaagctgaggattcaggtgtcctgctcaaaattgtt
aaaggaaatggtcaagttgtccctgtgactgaggtcattggttatattggttctgctggt
gaaacgattgaaacaaatgcagcgccagcagcttcagctgatgatctcaaagcagcgggt
cttgaagttcctgatactttaggcgagtcagcagcaccagcagctcaaaaaactccgctt
gctgatgatgagtatgatatgattgtcgttggtggtggtcctgctggttattatgctgct
attcgcggtgcacaattgggcggcaaggttgctatcgtcgaaaaatcagaatttggaggg
acttgtttaaataaaggctgcattccaactaaaacttatcttaagaatgctgaaatcctt
gatggcatcaaaattgcagcgggtcgcggtattaattttgcttcaaccaactataccatt
gacatggacaaaacggttgcctttaaagataccgttgttaaaacattgacaagtggggtt
cagggtcttcttaaagccaataaagtgactattttcaatggtctcggtcaggttaatcct
gataagacagtgactgtcggttcggaaacgattaaaggacataatattatccttgcaaca
ggttcaaaagtgtctcgtattaatattccgggaattgattcacctcttgttttaacatcg
gatgatattcttgatcttcgtgaaattccaaagtcacttgctgttatgggcggtggtgtt
gtcggcattgaactcggtcttgtttacgcttcctatggtacagaagtgactgttattgaa
atggctgatcgcattattcctgctatggacaaggaagtatcgcttgaactgcaaaaaatt
ctatccaagaaaggaatgaacattaagacttctgttggtgtggctgaaattgttgaagct
aacaatcaattaacgctgaaactcaatgacggctctgaagttgtggctgaaaaggccctg
ctttctattggtcgtgtcccacaattaagcggtttagaaaatcttaatctggaacttgaa
cgcggtcgcatcaaagtggacgattatcaggaaacctctatttcaggtatttatgccccg
ggtgatgttaatggaagaaagatgttagcgcatgctgcctatcgtatgggtgaagtagct
gccgaaaatgctatctggggaaatgttcgtaaggctaacctgaaatatacaccagcagct
gtttacacccatccagaggttgctatgtgcggtattactgaagaacaagcccgtcaagaa
tatggaaacgtcttagttgggaaatcctctttttcaggaaatggacgtgcgatcgcttct
aatgaagcacaaggatttgtcaaagttgtcgcagatgctaaataccatgaaattcttgga
gtccatattattggaccagcagctgctgagatgattaatgaagcctcaacgattatggaa
aatgagttgacggttgatgagctgctacgttctattcatggccatcctaccttctcggag
gttatgtatgaagcctttgcagacgtccttggcgaagctatccataacccgccaaagcgt
cgttaa

DBGET integrated database retrieval system