KEGG   Streptococcus mutans UA159 (serotype c): SMU_1424
Entry
SMU_1424          CDS       T00100                                 

Gene name
pdhD
Definition
(RefSeq) dihydrolipoamide dehydrogenase
  KO
K00382  dihydrolipoamide dehydrogenase [EC:1.8.1.4]
Organism
smu  Streptococcus mutans UA159 (serotype c)
Pathway
smu00010  Glycolysis / Gluconeogenesis
smu00020  Citrate cycle (TCA cycle)
smu00260  Glycine, serine and threonine metabolism
smu00280  Valine, leucine and isoleucine degradation
smu00310  Lysine degradation
smu00380  Tryptophan metabolism
smu00620  Pyruvate metabolism
smu00630  Glyoxylate and dicarboxylate metabolism
smu00640  Propanoate metabolism
smu01100  Metabolic pathways
smu01110  Biosynthesis of secondary metabolites
smu01120  Microbial metabolism in diverse environments
smu01200  Carbon metabolism
Module
smu_M00307  Pyruvate oxidation, pyruvate => acetyl-CoA
Brite
KEGG Orthology (KO) [BR:smu00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    SMU_1424 (pdhD)
   00020 Citrate cycle (TCA cycle)
    SMU_1424 (pdhD)
   00620 Pyruvate metabolism
    SMU_1424 (pdhD)
   00630 Glyoxylate and dicarboxylate metabolism
    SMU_1424 (pdhD)
   00640 Propanoate metabolism
    SMU_1424 (pdhD)
  09105 Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    SMU_1424 (pdhD)
   00280 Valine, leucine and isoleucine degradation
    SMU_1424 (pdhD)
   00310 Lysine degradation
    SMU_1424 (pdhD)
   00380 Tryptophan metabolism
    SMU_1424 (pdhD)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:smu04147]
    SMU_1424 (pdhD)
Enzymes [BR:smu01000]
 1. Oxidoreductases
  1.8  Acting on a sulfur group of donors
   1.8.1  With NAD+ or NADP+ as acceptor
    1.8.1.4  dihydrolipoyl dehydrogenase
     SMU_1424 (pdhD)
Exosome [BR:smu04147]
 Exosomal proteins
  Exosomal proteins of breast cancer cells
   SMU_1424 (pdhD)
SSDB
Motif
Pfam: Pyr_redox_2 Pyr_redox_dim Pyr_redox Pyr_redox_3 NAD_binding_8 FAD_oxidored AlaDh_PNT_C FAD_binding_2 GIDA DAO HI0933_like FAD_binding_3 NAD_binding_7 XdhC_C Thi4 Antig_Caf1 Trp_halogenase Lycopene_cycl K_oxygenase T2SSC 2-Hacid_dh_C 3HCDH_N
Other DBs
NCBI-GeneID: 1028688
NCBI-ProteinID: NP_721782
UniProt: Q8DTC8
LinkDB
Position
complement(1353362..1354699)
AA seq 445 aa
MAKYDLLIIGAGPGGYIAAEEAARLGKKVAVVEKKDIGGTCLNVGCIPSKAYLQHSHWLL
SMQEANKYGISTNLESVDFAKLVNRKDQVVSTLQGGIHTTFKSLKIDYYEGQAQFLKDKS
FMVNGEKISGKDVILATGSHPFIPQIHGINSVNYLTTDSFFNLKVLPEKLVIIGGGVIAI
ELAFAMQPLGVNVTVIEIAPQILLTEDKAARAIIRKKLKTMGAHIFEAAKIEEVHAQSVI
LEGDGAQEFDQLLVATGRKPNTELAQEMGLKLTERGFVKVDDYYETSTPHVYAIGDLTES
YMLAHVASMEGIKAVRAICRQAQDPVDAQGVPRSLYTNPEVASFGLSEEEAKEQGYDVLV
EQLPFSFNGRAIASTETQGFVKLISERRYHQILGAVIVGEHGTDLLQQLILLRQAEGTFD
QVVDAVYAHPTISELIQEVAKRIVQ
NT seq 1338 nt   +upstreamnt  +downstreamnt
ttggctaagtatgatcttttaattattggtgctggacccggtggttatattgcagctgaa
gaggctgcaagattaggcaaaaaagttgctgtcgttgaaaaaaaagacattggcggaact
tgtttaaacgttggctgtattccttccaaggcttatctgcagcacagtcattggttatta
tcaatgcaggaagctaacaaatacggcatttcaactaatcttgaaagtgtagactttgct
aagttagtcaatcgtaaagatcaggttgtttcgactttacaaggaggtattcacacaact
tttaaatctctaaaaattgattattatgaaggccaagcacaatttcttaaagacaagagc
tttatggtcaatggtgaaaagatttctgggaaagatgttattttagcgactggtagccat
ccttttattccgcaaattcatggtattaattcggtgaattacctaacaacagatagcttt
ttcaatttaaaagttttaccagagaaattggttatcattggtgggggtgttattgcgatt
gaattagcctttgccatgcagccattgggtgtgaatgtcactgtcattgaaattgcaccg
caaatactattgacagaggataaagctgcacgtgctattatcagaaagaaactcaaaaca
atgggagctcatatttttgaagctgctaagatagaagaagtacatgctcaatcagttatt
ttagagggggatggcgctcaagaatttgaccagttgttagttgcaacaggacgtaagcct
aatacagaattagctcaggaaatgggattaaagctaacagaacgtggttttgtcaaagtt
gatgattactatgaaacgtctactccacatgtttatgctatcggtgacttgacggaaagt
tatatgctagctcatgttgccagcatggaaggcatcaaagctgttagagctatttgtcgt
caggcacaggatcctgttgatgctcaaggtgtaccgcgttcgctctacaccaatccggaa
gtggcttcctttggactgagtgaagaggaggctaaagaacaaggttatgatgtcctcgtt
gaacaattaccattttctttcaacggacgggccattgcatcaacagagacgcaaggattt
gttaaactgatttcggaaaggaggtatcatcaaattttaggggctgttattgttggcgaa
catgggacagatttgttgcaacaattgattttattgagacaggcagaaggaacttttgat
caagttgttgatgcagtctatgcccatccgacaatttcagaactcattcaagaagttgct
aagcgaattgttcagtaa

DBGET integrated database retrieval system