KEGG   Streptococcus mutans UA159 (serotype c): SMU_1826Help
Entry
SMU_1826          CDS       T00100                                 

Gene name
yfbQ
Definition
(RefSeq) aminotransferase
  KO
K14260  alanine-synthesizing transaminase [EC:2.6.1.66 2.6.1.2]
Organism
smu  Streptococcus mutans UA159 (serotype c)
Pathway
smu00220  Arginine biosynthesis
smu00250  Alanine, aspartate and glutamate metabolism
smu00290  Valine, leucine and isoleucine biosynthesis
smu01100  Metabolic pathways
smu01110  Biosynthesis of secondary metabolites
smu01130  Biosynthesis of antibiotics
smu01210  2-Oxocarboxylic acid metabolism
smu01230  Biosynthesis of amino acids
Brite
KEGG Orthology (KO) [BR:smu00001]
 Metabolism
  Amino acid metabolism
   00250 Alanine, aspartate and glutamate metabolism
    SMU_1826 (yfbQ)
   00290 Valine, leucine and isoleucine biosynthesis
    SMU_1826 (yfbQ)
   00220 Arginine biosynthesis
    SMU_1826 (yfbQ)
Enzymes [BR:smu01000]
 2. Transferases
  2.6  Transferring nitrogenous groups
   2.6.1  Transaminases
    2.6.1.2  alanine transaminase
     SMU_1826 (yfbQ)
    2.6.1.66  valine---pyruvate transaminase
     SMU_1826 (yfbQ)
Amino acid related enzymes [BR:smu01007]
 Aminotransferase (transaminase)
  Class I
   SMU_1826 (yfbQ)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Aminotran_1_2 Aminotran_5 DegT_DnrJ_EryC1 Cys_Met_Meta_PP
Motif
Other DBs
NCBI-GeneID: 1029041
NCBI-ProteinID: NP_722144
UniProt: Q8DSG1
LinkDB All DBs
Position
complement(1722792..1724009)
Genome map
AA seq 405 aa AA seqDB search
MMKEFNKSAKLEHVAYDIRGPVLEEADRMIANGEKILRLNTGNPAAFGLTAPDEVIRDLI
MNARESEGYSDSKGIFSARKAIMQYCQLKNIPDVDVDDIYIGNGVSEMITMSMQGLLDDG
DEVLVPMPDYPLWTAAVSLAGGQAVHYVCDESSNWYPDIDNIKSKITSNTKALVVINPNN
PTGALYPKDVLEDIVEVARQNDLIIFADEIYDRLVMDGGEHVAIASLAPDLFCVSMNGLS
KSHRIAGFRVGWMVLSGPKKHVKDYIEGLNMLSNMRLCSNVLAQQVIQTSLGGVQSIDEL
LLPGGRIYEQRNFIYKAMNEIPGITAVKPQAGLYIFPKIDRNMYRIDDDEQFVLNFLKQE
KILLVHGRGFNWMEPDHFRIVYLPRVEELSKIQEKMTRFLGQYRK
NT seq 1218 nt NT seq  +upstreamnt  +downstreamnt
atgatgaaagaatttaataagtctgctaaacttgaacatgtggcctatgatattcgcggt
ccagtattagaagaagccgatcgtatgattgctaatggggagaaaatcttacgtcttaat
acaggaaatcctgccgcttttggattaacagcacctgatgaggttattcgggatttaatt
atgaatgcgcgtgagagcgaaggttattcagattcgaagggaatcttttcagctcgtaaa
gctattatgcaatattgtcagcttaaaaatattcctgatgttgatgttgatgacatctat
attggcaatggtgtatcggaaatgattactatgtctatgcaaggacttttagatgacggt
gacgaagttttagtccccatgcctgattatccactgtggacggctgctgttagtctggca
ggaggtcaggctgttcattatgtctgtgatgaaagttccaattggtatccagatattgat
aatattaagtctaaaatcacttcaaatacgaaagctcttgtggttatcaatcctaataac
cctacaggggctctttatcccaaagatgtattagaagatatcgttgaagttgctcgtcag
aatgatttaattatttttgctgatgagatttatgatcgtctggtcatggatggtggggaa
catgtggctattgctagtcttgcaccggatcttttttgtgtttctatgaatggtttgtca
aaatcccatcgtattgcaggtttccgtgtaggttggatggttttatctgggcctaaaaaa
catgtcaaagattatattgaaggccttaacatgctttcaaatatgcgcctttgttctaat
gttctggctcaacaagttattcaaacatctttgggcggcgttcagtctattgatgaactt
cttttgccgggtggccgtatttatgaacagcgtaattttatttataaagctatgaatgaa
atccctggaatcacagcggtaaaacctcaggcgggactttatattttcccaaaaattgac
cgtaatatgtatcggattgatgatgatgagcaatttgttctgaattttctcaaacaggaa
aaaatccttcttgttcatggacgcggctttaactggatggaaccagatcatttccgtatt
gtttatttaccgcgcgttgaagagctctctaagattcaagaaaagatgacacgcttccta
gggcaatatcgaaaataa

DBGET integrated database retrieval system