KEGG   Streptococcus mutans UA159 (serotype c): SMU_366
Entry
SMU_366           CDS       T00100                                 

Gene name
gltB
Definition
(RefSeq) glutamate synthase
  KO
K00266  glutamate synthase (NADPH) small chain [EC:1.4.1.13]
Organism
smu  Streptococcus mutans UA159 (serotype c)
Pathway
smu00250  Alanine, aspartate and glutamate metabolism
smu00910  Nitrogen metabolism
smu01100  Metabolic pathways
smu01110  Biosynthesis of secondary metabolites
smu01120  Microbial metabolism in diverse environments
smu01230  Biosynthesis of amino acids
Brite
KEGG Orthology (KO) [BR:smu00001]
 09100 Metabolism
  09102 Energy metabolism
   00910 Nitrogen metabolism
    SMU_366 (gltB)
  09105 Amino acid metabolism
   00250 Alanine, aspartate and glutamate metabolism
    SMU_366 (gltB)
Enzymes [BR:smu01000]
 1. Oxidoreductases
  1.4  Acting on the CH-NH2 group of donors
   1.4.1  With NAD+ or NADP+ as acceptor
    1.4.1.13  glutamate synthase (NADPH)
     SMU_366 (gltB)
SSDB
Motif
Pfam: Pyr_redox_2 Fer4_20 Pyr_redox NAD_binding_8 DAO Amino_oxidase Pyr_redox_3 AlaDh_PNT_C FAD_binding_2 HI0933_like FAD_oxidored GIDA FAD_binding_3 NAD_binding_9 Thi4 NAD_binding_7 FMO-like 2-Hacid_dh_C Lycopene_cycl ApbA
Other DBs
NCBI-GeneID: 1027912
NCBI-ProteinID: NP_720818
UniProt: Q8CWY8
LinkDB
Position
347579..349015
AA seq 478 aa
MADPFGFLKYERKDNPYRPVNERIKDFEELQTTLSVEERQKQAARCMNCGIPFCHEGTFY
GGGRAVSGCPNDNLIPEWNDLIYKGDFRRAFERLTRTNPLPEMTGRVCPAPCEKACTEGL
NGSGVTIHDNERFIIDNAFEEGWVADSGRPIERTGFKVAVVGSGPAGLSAAWRLNQLGHS
VTVFERSDRFGGLLMYGIPNMKLDKKIVQRRIDTMASIGINFVANTEIGRDITAEELLEK
FDRVILATGASVPRDLDIPGRDLKGIRFAVDFLTETTKNLLDSDTHELPPLLEGKHVLVI
GGGDTGNDCIGTAVRLGAASVRQLEITPQLPEKRLPTNPWPQYPMINRTGYGQEEADFVQ
QTDLTDYITSTVEFLGENGQVTAVKTIKVGPGFKAIEGTEEVIKADLVLLAMGFTGAEKA
LFDQFRVECVYDDYSTRNEKVFVAGDARRGPSLVIWGIREGRKTAEKIDQNLRMMVTE
NT seq 1437 nt   +upstreamnt  +downstreamnt
atggcagatccgtttggatttttaaagtatgagcgcaaggacaatccctatcgtcctgtt
aatgagcgtatcaaagattttgaagaattgcagacaactttatcagttgaggaacgtcaa
aagcaagctgctcgctgtatgaattgtgggatccctttctgtcatgagggaactttctat
ggtggcggtcgtgctgtttcaggttgtcccaatgacaatttaatccctgaatggaatgat
ttgatttataagggcgatttcagacgtgcttttgaacgcttgacacgaactaacccttta
ccagaaatgacaggtcgtgtctgcccggcaccttgtgaaaaggcctgtacagaaggctta
aatggttcgggtgttaccattcatgataatgaacgttttattattgataatgcatttgaa
gaaggctgggtagctgattctggtcgccctattgagcgtacaggttttaaagtagctgtc
gtaggttcaggtcctgctggcctgtcagctgcttggcgtcttaaccagttgggtcacagt
gtaactgtgtttgagcgttctgatcgctttggtggtttgctcatgtatggtattcccaat
atgaaattggataagaaaattgtgcaacgccgtattgatacgatggcttcaattggtatt
aattttgttgccaatacagaaattggtcgtgatattacagcagaagaattattagaaaaa
tttgaccgtgtaatcttggcaactggagctagcgttcctcgtgacttggatattccaggc
cgtgacttaaaaggcattcgatttgctgttgatttcttaacagaaacgactaaaaatctt
ttggacagtgacacacacgaattaccgcccttgcttgaaggaaaacatgtcttagttatt
ggcggtggcgatactggaaatgactgtatcggtacggctgttcgtttgggagctgctagt
gttagacaattagaaattacgccgcaactgcctgaaaagcgtctgccaacaaatccatgg
ccacaatatcctatgattaatcgtacaggctatggacaggaagaagccgattttgttcaa
cagactgatttgacggactatatcacgtcaacagtagaatttcttggtgaaaatggccaa
gtgactgcggtgaagacaattaaggttggacctggtttcaaagccattgaaggaactgaa
gaggtaattaaggcagatcttgttcttcttgctatgggcttcacaggtgctgaaaaagcg
ctctttgaccaattccgagttgaatgtgtttatgatgactattcaactcgaaatgagaag
gtttttgttgcaggtgatgcacgccgtggtcctagtcttgttatttggggaattcgagaa
ggacgcaaaacagcagagaaaattgatcaaaacctcagaatgatggttacagagtga

DBGET integrated database retrieval system