KEGG   Streptococcus mutans UA159 (serotype c): SMU_463
Entry
SMU_463           CDS       T00100                                 

Gene name
trxB
Definition
(RefSeq) thioredoxin reductase
  KO
K00384  thioredoxin reductase (NADPH) [EC:1.8.1.9]
Organism
smu  Streptococcus mutans UA159 (serotype c)
Pathway
smu00450  Selenocompound metabolism
Brite
KEGG Orthology (KO) [BR:smu00001]
 09100 Metabolism
  09106 Metabolism of other amino acids
   00450 Selenocompound metabolism
    SMU_463 (trxB)
Enzymes [BR:smu01000]
 1. Oxidoreductases
  1.8  Acting on a sulfur group of donors
   1.8.1  With NAD+ or NADP+ as acceptor
    1.8.1.9  thioredoxin-disulfide reductase
     SMU_463 (trxB)
SSDB
Motif
Pfam: Pyr_redox_2 Pyr_redox_3 Pyr_redox FAD_binding_2 DAO GIDA FAD_oxidored HI0933_like NAD_binding_8 Thi4 Lycopene_cycl NAD_binding_7 K_oxygenase FAD_binding_3 MCRA Trp_halogenase
Other DBs
NCBI-GeneID: 1029596
NCBI-ProteinID: NP_720906
UniProt: Q8DVL7
LinkDB
Position
430700..431614
AA seq 304 aa
MYDTIIIGSGPAGMTAALYAARSNLKVALIEQGAPGGQMNNTSDIENYPGYDLISGPELS
MKMHEPLEKFGVENLYGIVTAVEDHGNFKKVLTDDNSYETKTVIIATGAKHRPLAVAGEE
TYNSRGVSYCAVCDGAFFRGQDLLVVGGGDSAVEEALFLTRFANKVTIVHRRDELRAQKV
LQERAFANDKVDFIWDSVVKEIKGNDLKVTNVDIENVKTGQVNNYAFGGVFIYVGLDPVS
SMVKELDITDEAGWIPTDDHMKTKVAGVFAIGDVRQKDLRQITTAVGDGAVAAQEAYQYI
VNNY
NT seq 915 nt   +upstreamnt  +downstreamnt
atgtacgatacaattattattggctcaggtcctgctggcatgacagctgccctctatgct
gctagaagcaatctcaaagttgctctaatagaacaaggtgcgcccggcggtcaaatgaat
aatacctctgatattgaaaattatcccggttatgacttgatttctggaccagaactatca
atgaaaatgcatgaaccacttgaaaaatttggtgttgaaaatctctatggtattgtaacc
gctgttgaagatcatggtaatttcaagaaggtccttacggatgacaatagctatgaaacc
aaaactgttatcattgctacaggtgctaaacaccgccctcttgctgtcgctggtgaagaa
acctataatagtcgcggtgtttcttactgtgctgtttgtgatggtgcttttttccgcggc
caggacttgttagttgttggtggtggcgattcagccgttgaggaagctcttttcttaacc
agatttgccaacaaagttactattgtccatcgccgtgatgaactgcgtgcgcaaaaagta
ttgcaagaacgtgcctttgccaatgataaagtagactttatctgggattctgttgttaaa
gaaatcaaagggaatgatcttaaggtaaccaatgttgatattgaaaatgtcaaaacaggt
caagtaaacaattatgcctttggtggtgtctttatctatgttggcttagatcctgtctca
agtatggttaaggaattagatatcacagatgaagctggttggattccaacagatgatcat
atgaagacgaaagtagcaggcgtttttgctatcggtgatgtccgccaaaaagatcttcgt
caaattacgacagctgttggcgatggtgccgtagcagctcaagaagcctatcaatatatt
gtcaataactattaa

DBGET integrated database retrieval system