KEGG   Streptococcus mutans UA159 (serotype c): SMU_484Help
Entry
SMU_484           CDS       T00100                                 

Gene name
pknB
Definition
(RefSeq) serine/threonine protein kinase
  KO
K12132  eukaryotic-like serine/threonine-protein kinase [EC:2.7.11.1]
Organism
smu  Streptococcus mutans UA159 (serotype c)
Brite
KEGG Orthology (KO) [BR:smu00001]
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:smu01001]
    SMU_484 (pknB)
Enzymes [BR:smu01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.1  non-specific serine/threonine protein kinase
     SMU_484 (pknB)
Protein kinases [BR:smu01001]
 Serine/threonine kinases: Other
  Bacterial family
   SMU_484 (pknB)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Pkinase Pkinase_Tyr PASTA APH Kdo RIO1 Kinase-like Pkinase_fungal FTA2
Motif
Other DBs
NCBI-GeneID: 1029535
NCBI-ProteinID: NP_720924
UniProt: Q8DVK1
LinkDB All DBs
Position
452362..454212
Genome map
AA seq 616 aa AA seqDB search
MIQIGKLFAGRYRILQSIGRGGMADVYLANDLILDNEEVAIKVLRTNYQTDQVAVTRFQR
EARAMAELNHPNIVAIRDIGEEDGQQFLAMEYVDGADLKKYIQDHAPLSNAEVIRIMKEV
LSAMTLAHQKGIIHRDLKPQNVLLTKDGTAKVTDFGIAVAFAETSLTQTNSMLGSVHYLS
PEQARGSKATVQSDIYAMGIMLFEMLTGHIPYDGDSAVTIALQHFQKPLPSIIAENKNVP
QALENVVIKATAKRLTDRYHSTQEMLQDLRTSLQPNRSRERKLVFSDASDTKPLPKLEQA
AANSLAAQSLKNKTSNQDKVDHKSKPKTKPQPKPKKKRHFLARFFKIFFILVAIGIAVLT
YLVLTKPSTVSVPDVSGDKLSTAKMIIRKSGLKVGDVQKIEDDNVGAGKVVRTNPSAGSK
KREGSSVDIFVASAKGFKMEDYTGQDYKDAIDNLTNNYGVSRDSIVLKEVSSDDYSGGTV
IGQSPKPGKTYHPSSDKKITLKVVKVTMPNLKNSTYEEAVSTLTAMGISSSRIKAYDASD
YSSEISSPSSSSLVVGQSPYYGNTVSLSSNDDIILYVSTSGGSHSGSSSSESSNSEGTTS
SEASTDSSSSATTTSH
NT seq 1851 nt NT seq  +upstreamnt  +downstreamnt
atgattcagattggcaaattatttgctggtcgttatcggattctccagtctatcggacga
ggtgggatggcggatgtttatttagctaatgatttgattttagataatgaggaagtggcc
attaaggttctacgtacgaattatcagacagatcaggttgctgtgacacgttttcagcgg
gaagcacgtgccatggcagaacttaatcatcctaatattgtagccattcgtgacattgga
gaagaagacggtcagcaattccttgcaatggaatatgttgatggcgccgacttgaagaaa
tacattcaagatcacgctcctttatcaaatgctgaagtcattagaatcatgaaagaggtt
ctttctgctatgactcttgcccaccaaaagggcattattcatcgggatttaaaacctcaa
aatgttttactgaccaaagatggaacggctaaagtaacagactttggtattgctgtggct
tttgctgaaacgagtttgacccaaaccaattcaatgctgggttcagtacattacttatct
cctgaacaggcgcgtggttctaaggctactgttcaaagtgatatctatgcaatggggatt
atgctttttgaaatgctgacagggcatattccctatgatggcgatagtgctgttacaatt
gctttgcagcattttcaaaagcctttaccatctattattgctgagaataaaaatgtccct
caagctcttgaaaatgttgttattaaagcaacagctaaacgattaacggaccgctatcat
tcaacgcaggagatgttgcaggatttaagaacgtctctgcagccgaatcgcagccgtgaa
agaaagcttgttttcagtgatgcttcagatacaaaaccactaccaaaactggaacaggca
gcagcaaactctttagctgctcagtccttaaaaaacaaaacttccaatcaggataaagta
gatcataaatctaagcctaaaaccaaaccacaacctaagcctaagaaaaaaagacatttt
ttagctcgtttctttaaaatcttctttatattagttgccattggtattgctgttttgacc
tacctggttctgacaaaaccgagtactgtttcagttcctgacgtttcaggagataaatta
tcaacggccaagatgattattagaaaatcgggtcttaaggtgggtgacgttcaaaaaatt
gaggatgataacgttggtgctggaaaggtcgtaagaactaatccaagtgcaggcagtaaa
aaacgtgaaggttctagtgttgatatttttgtagctagtgctaagggatttaagatggag
gactataccggtcaagattacaaggatgctattgataatctgactaataattatggtgtt
tctagggacagtattgttcttaaggaagtttcatctgatgactacagtggtggaactgtt
atcggtcaatcaccaaaacccggaaagacctatcatcctagcagtgataaaaaaataact
ctcaaggttgtcaaagtcactatgccaaatcttaaaaattctacttatgaagaggctgtc
agtactttaacagctatggggatttcttcaagccgtataaaagcttatgatgccagcgat
tactcatcagaaatttcatcaccatcatcttcgtcactcgttgtcggtcaaagtccttat
tatggtaatactgtcagtctgtcatctaatgatgatattatcttgtatgtttcaacatca
ggtggctctcattctggttcgtcgtcgtctgaatcttcgaacagtgaaggaacaacatca
agcgaagcctcgacagactctagttcaagtgcgacgacaacttcacattaa

DBGET integrated database retrieval system