KEGG   Streptococcus mutans UA159 (serotype c): SMU_629Help
Entry
SMU_629           CDS       T00100                                 

Gene name
sod
Definition
(RefSeq) manganese-type superoxide dismutase, Fe/Mn-SOD
  KO
K04564  superoxide dismutase, Fe-Mn family [EC:1.15.1.1]
Organism
smu  Streptococcus mutans UA159 (serotype c)
Brite
Enzymes [BR:smu01000]
 1. Oxidoreductases
  1.15  Acting on superoxide as acceptor
   1.15.1  Acting on superoxide as acceptor (only sub-subclass identified to date)
    1.15.1.1  superoxide dismutase
     SMU_629 (sod)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Sod_Fe_C Sod_Fe_N
Motif
Other DBs
NCBI-GeneID: 1029605
NCBI-ProteinID: NP_721057
UniProt: P09738
LinkDB All DBs
Structure
PDB: 

Position
588268..588879
Genome map
AA seq 203 aa AA seqDB search
MAILLPDLPYAYDALEPYIDAETMTLHHDKHHATYVANANAALEKHPEIGENLEVLLADV
EQIPADIRQSLINNGGGHLNHALFWELLSPEKTKVTAEVAAAINEAFGSFDDFKAAFTAA
ATTRFGSGWAWLVVDKEGKLEVTSTANQDTPISQGLKPILALDVWEHAYYLNYRNVRPNY
IKAFFEVINWNTVARLYAEALTK
NT seq 612 nt NT seq  +upstreamnt  +downstreamnt
atggctattcttttaccagatcttccatatgcttatgacgcacttgaaccatatattgat
gctgaaacgatgacccttcatcatgataagcatcatgcaacttatgtcgcaaacgctaat
gcggctcttgaaaaacatccagaaatcggagaaaatttggaagtgcttttggctgatgtg
gaacaaattccagcggatattcgtcagtctttgattaataatggtggcggtcatcttaat
cacgctcttttctgggaactcttgtcaccagaaaagacaaaagttactgcggaagtagcc
gcagcaattaatgaagcttttggctcatttgatgattttaaagcagcttttacagctgcc
gcaacgacgcgttttggctcaggttgggcttggttagtagttgataaagaaggaaaactt
gaagtgacctcaacagctaatcaagatactccaatttcacagggcttgaaaccaattcta
gcacttgatgtctgggaacacgcttattatctcaattatcgtaatgttcgtccaaactat
atcaaagccttctttgaagttatcaattggaacactgttgctcgtctttatgccgaagct
ctcactaaataa

DBGET integrated database retrieval system