KEGG   Streptococcus mutans UA159 (serotype c): SMU_765Help
Entry
SMU_765           CDS       T00100                                 

Definition
(RefSeq) alkyl hydroperoxide reductase
  KO
K03387  NADH-dependent peroxiredoxin subunit F [EC:1.8.1.-]
Organism
smu  Streptococcus mutans UA159 (serotype c)
Brite
KEGG Orthology (KO) [BR:smu00001]
 09190 Not Included in Pathway or Brite
  09191 Unclassified: metabolism
   99980 Enzymes with EC numbers
    SMU_765
Enzymes [BR:smu01000]
 1. Oxidoreductases
  1.8  Acting on a sulfur group of donors
   1.8.1  With NAD+ or NADP+ as acceptor
    1.8.1.-  
     SMU_765
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Pyr_redox_2 Pyr_redox_3 Pyr_redox GIDA Thioredoxin_3 FAD_oxidored FAD_binding_2 Thi4 HI0933_like AlaDh_PNT_C FAD_binding_3 DAO NAD_binding_8 Ribosomal_L21p FMO-like K_oxygenase Auto_anti-p27
Motif
Other DBs
NCBI-GeneID: 1028152
NCBI-ProteinID: NP_721179
UniProt: I6L922
LinkDB All DBs
Position
713482..715014
Genome map
AA seq 510 aa AA seqDB search
MALDAEIKEQLGQYLQLLESEIVLQAQLKDDANSQKVKEFLQEIVAMSPMISLEEKELPR
TPSFRIAKKGQESGVEFAGLPLGHEFTSFILALLQVSGRPPKVETDIVKRIQAVDEPMHF
ETYVSLTCHNCPDVVQAFNIMSVVNPNISHTMVEGGMFKDEIEAKGIMSVPTVYKDGTEF
TSGRASIEQLLDLIAGPLKEDAFDDKGVFDVLVIGGGPAGNSAAIYAARKGVKTGLLAET
MGGQVMETVGIENMIGTPYVEGPQLMAQVEEHTKSYSVDIMKAPRAKSIQKTDLVEVELD
NGAHLKAKTAVLALGAKWRKINVPGEKEFFNKGVTYCPHCDGPLFTDKKVAVIGGGNSGL
EAAIDLAGLASHVYILEFLPELKADKILQDRAEALDNITILTNVATKEIIGNDHVEGLRY
SDRTTNEEYLLDLEGVFVQIGLVPSTDWLKDSGLALNEKGEIIVAKDGATNIPAIFAAGD
CTDSAYKQIIISMGSGATAALGAFDYLIRN
NT seq 1533 nt NT seq  +upstreamnt  +downstreamnt
atggcattagacgcagaaatcaaagagcagttaggacagtatcttcaattacttgagtct
gagattgttttacaagctcaattaaaagacgatgctaattctcaaaaagttaaggaattt
ctccaagaaatcgttgcaatgtctcctatgatttctttagaagaaaaggaacttccgcga
acacctagttttcgcatagctaaaaagggacaagaatctggtgttgaatttgctggctta
ccccttggtcacgaatttacttcgtttatcttggctctgttacaggtttcagggcgtccg
cctaaggtagagactgatattgtcaaacgcattcaagctgttgatgaacctatgcatttt
gaaacctatgttagtttgacttgtcataattgtccagatgttgttcaggctttcaatatc
atgtcagttgttaatcccaacatttcacatacaatggtggaaggtggcatgtttaaagat
gaaattgaagctaagggaattatgtctgtgccaactgtctataaagatggaacagaattt
acctcagggcgtgctagcatagagcaattactagacttgatagcaggtcctcttaaagaa
gatgcttttgatgataaaggtgtttttgatgtccttgttattggtgggggtcctgctggt
aatagcgcggctatctatgctgcaagaaagggagttaaaacaggacttttagctgaaacc
atgggtggtcaagttatggaaaccgtgggtattgaaaatatgatcggtaccccatatgtt
gaaggaccccaattaatggctcaggtggaagagcataccaagtcttattctgttgacatc
atgaaggcaccgcgtgctaagtctattcaaaagacagacttggttgaagttgaacttgat
aatggagctcatttgaaagcaaagacagctgttttggccttaggtgccaagtggcgtaaa
atcaatgtaccaggagaaaaagaattctttaataaaggtgttacttactgtccgcactgt
gatggtcctcttttcacagacaaaaaagtcgctgtcattggcggtggaaactcaggttta
gaagcagctattgatttggctgggttagctagccatgtctatattttagaatttttacct
gagttaaaagctgataagatcttacaagatcgtgcggaagctcttgataatattaccatt
ctaactaatgttgcgactaaagaaattattggcaatgaccacgtagaaggtcttcgttac
agtgatcgtacgaccaatgaagagtacttgcttgatttagaaggtgtttttgttcaaatt
ggattggtacctagtactgactggttaaaggatagtggactagcactcaatgaaaaaggt
gaaatcattgttgctaaagatggcgcaactaatattcctgctatttttgcagctggtgat
tgcacagatagtgcctacaaacaaattatcatttccatgggttctggagctactgcggct
ttaggtgcctttgattatttgattagaaattaa

DBGET integrated database retrieval system