KEGG   Streptococcus mutans UA159 (serotype c): SMU_869
Entry
SMU_869           CDS       T00100                                 

Gene name
trxB2
Definition
(RefSeq) thioredoxin reductase
  KO
K21567  ferredoxin/flavodoxin---NADP+ reductase [EC:1.18.1.2 1.19.1.1]
Organism
smu  Streptococcus mutans UA159 (serotype c)
Brite
KEGG Orthology (KO) [BR:smu00001]
 09190 Not Included in Pathway or Brite
  09191 Unclassified: metabolism
   99980 Enzymes with EC numbers
    SMU_869 (trxB2)
Enzymes [BR:smu01000]
 1. Oxidoreductases
  1.18  Acting on iron-sulfur proteins as donors
   1.18.1  With NAD+ or NADP+ as acceptor
    1.18.1.2  ferredoxin---NADP+ reductase
     SMU_869 (trxB2)
  1.19  Acting on reduced flavodoxin as donor
   1.19.1  With NAD+ or NADP+ as acceptor
    1.19.1.1  flavodoxin---NADP+ reductase
     SMU_869 (trxB2)
SSDB
Motif
Pfam: Pyr_redox_2 Pyr_redox_3 Pyr_redox HI0933_like K_oxygenase DAO NAD_binding_8 FAD_oxidored Thi4 NAD_binding_7 FAD_binding_3 FMO-like Semialdhyde_dhC FAD_binding_2
Other DBs
NCBI-GeneID: 1029447
NCBI-ProteinID: NP_721278
UniProt: Q8DUN5 Q1LZ62
LinkDB
Position
816615..817628
AA seq 337 aa
MEEEKLTSEKEIYDITVIGGGPVGLFTAFYAGLRGISVKVIESLSELGGQPAILYPEKVI
YDIPAFPAITGADLVDNLIEQLERFKDKTTICLKEEVKTFEKENAIFTITTNKGNHFSKA
IIIACGNGAFAPRRLGLDDEERYADHNLFYNVHKLDQFAGKKVVICGGGDSAVDWANALD
KIAESVTLVHRRDAFRAHEHSVEVLKTSHVNIMTPYVPLELKGEGDEATSLVIQKVKSEE
TKELSLDSLIVSFGFSTSNKNLKSWNIDYKRSSINVSPLFETSQTGVFAIGDAAEYEGKI
DLIATGFGEAPTAVNQAIKYIYPERDNRVVHSTSLIK
NT seq 1014 nt   +upstreamnt  +downstreamnt
atggaggaagaaaaattgacatctgaaaaagagatttatgatataaccgttatcggtggc
ggaccggttggtctttttacagctttttatgctggtttgcgtggtatttctgtaaaagtg
attgaaagtttatctgagcttggtggtcaaccagccattttatatccagaaaaggtgatt
tatgatatcccagcctttcctgctattactggagcagatttggtagataatctgattgaa
caattggagcgctttaaggataaaacgactatttgtttaaaagaagaagttaaaacattt
gaaaaagagaatgctatttttacaattacaacaaataaagggaatcatttttcgaaagcc
attattattgcttgtggaaatggtgcctttgcgccgcgtcgattgggcttggacgatgag
gaacgttatgcagaccataatctcttttacaatgttcacaaactagaccaatttgctggt
aaaaaggttgttatttgtggtggcggcgactctgctgttgactgggctaatgctctggat
aagattgctgaaagtgtcacattggtacaccgtcgtgatgcctttcgcgctcatgaacat
agtgtagaagttctgaaaacttctcatgttaatatcatgacaccttacgtaccgcttgag
ttaaaaggagaaggtgatgaagcaaccagtcttgtgattcaaaaggtcaaatcagaagaa
accaaagagttgtcacttgattcgcttattgttagttttggattttcaacctccaacaaa
aacctcaaaagttggaatattgattataagcgttcaagtattaatgtatctcctcttttt
gaaaccagtcagacaggggtttttgctattggagatgctgcagaatatgaaggcaaaatt
gatttaattgcaacaggatttggagaggcaccaacagcagttaaccaagccatcaaatac
atttatcctgagcgtgataatcgtgtcgttcattccacatcattgataaaataa

DBGET integrated database retrieval system