KEGG   Streptococcus mutans UA159-FR: SMUFR_0106Help
Entry
SMUFR_0106        CDS       T03797                                 

Gene name
dlaT
Definition
(GenBank) branched-chain alpha-keto acid dehydrogenase E2 subunit
  KO
K00627  pyruvate dehydrogenase E2 component (dihydrolipoamide acetyltransferase) [EC:2.3.1.12]
Organism
smua  Streptococcus mutans UA159-FR
Pathway
smua00010  Glycolysis / Gluconeogenesis
smua00020  Citrate cycle (TCA cycle)
smua00620  Pyruvate metabolism
smua01100  Metabolic pathways
smua01110  Biosynthesis of secondary metabolites
smua01120  Microbial metabolism in diverse environments
smua01130  Biosynthesis of antibiotics
smua01200  Carbon metabolism
Module
smua_M00307  Pyruvate oxidation, pyruvate => acetyl-CoA
Brite
KEGG Orthology (KO) [BR:smua00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    SMUFR_0106 (dlaT)
   00020 Citrate cycle (TCA cycle)
    SMUFR_0106 (dlaT)
   00620 Pyruvate metabolism
    SMUFR_0106 (dlaT)
Enzymes [BR:smua01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.12  dihydrolipoyllysine-residue acetyltransferase
     SMUFR_0106 (dlaT)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 2-oxoacid_dh E3_binding Biotin_lipoyl Biotin_lipoyl_2 PLA2_B
Motif
Other DBs
NCBI-ProteinID: AJD54582
LinkDB All DBs
Position
131087..132454
Genome map
AA seq 455 aa AA seqDB search
MAVEIIMPKLGVDMQEGEIIEWKKQEGDEVKEGEILLEIMSDKTNMEIEAEDSGVLLKIV
KGNGQVVPVTEVIGYIGQAGEVLEIADVPASTVPKENSAAPAEKTKAMSSPTVAAAPQGK
IRATPAARKAARDLGVNLNQVSGTGAKGRVHKEDVESFKAAQPKATPLARKIAIDKGIDL
ASVSGTGFGGKIIKEDILNLFEAAQPVNDVSDPAKEAAALPEGVEVIKMSAMRKAVAKSM
VNSYLTAPTFTLNYDIDMTEMIALRKKLIDPIMEKTGFKVSFTDLIGLAVVKTLMKPEHR
YLNASLINDATEIELHQFVNLGIAVGLDEGLLVPVVHGADKMSLSDFVIASKDVIKKAQT
GKLKATEMSGSTFSITNLGMFGTKTFNPIINQPNSAILGVGATIQTPTVVDGEIKIRPIM
ALCLTIDHRLVDGMNGAKFMVDLKKLMENPFTLLI
NT seq 1368 nt NT seq  +upstreamnt  +downstreamnt
atggcagtcgaaattattatgcctaaacttggtgttgatatgcaggaaggcgaaatcatc
gagtggaaaaaacaagaaggtgatgaggtcaaagaaggggagatcctccttgagattatg
tctgacaagaccaatatggaaatcgaagctgaggattcaggtgtcctgcttaagattgtt
aaaggaaatggtcaagttgttcctgtaactgaggtcattggttatattggtcaagcaggt
gaagttcttgaaatagctgatgttcctgcaagtacagttcctaaagaaaatagtgcagca
cctgctgaaaaaacaaaagcaatgtcttctccgacagttgcagcagcccctcaaggaaag
attcgagcaacaccagcagctcgtaaggcggctcgtgatctgggagttaacctgaatcag
gtttcagggacaggcgctaaaggccgtgttcacaaggaagatgttgaaagctttaaagca
gctcagcctaaagcaacaccattagctaggaaaattgctatagataaaggtattgatcta
gccagtgtctcaggaacaggttttggcggcaaaattatcaaggaagatattttaaatctg
tttgaggcagctcagcctgttaatgatgtgtcagatcctgctaaagaagcagctgcctta
ccagagggtgttgaagtcattaagatgtctgccatgcgtaaggcagtggctaaaagcatg
gtcaattcttacctgacagctccaacttttactctcaattatgacattgacatgactgag
atgattgcgttgcgtaaaaagttaattgatcctatcatggaaaaaacaggttttaaagtt
agcttcacagatttgattggtctggcagtcgtaaaaaccttaatgaaaccagaacatcgt
tacctcaatgcttcactcattaatgacgcgactgagattgaacttcatcaatttgttaac
cttggtatcgccgttggacttgatgaaggactgttagtacctgttgttcatggtgcagat
aagatgagcttgtcagattttgttatagcttcaaaggatgtcattaagaaagctcagacc
ggtaaattaaaagccactgaaatgtctggttcaaccttttccattacaaacttggggatg
tttggcactaagactttcaaccccattatcaatcagccaaattcggctattttgggtgta
ggagcaactatccaaacgccaactgttgtggatggtgaaattaagattcgtccaatcatg
gcactgtgcttgaccatcgatcaccgcttggttgatggcatgaacggcgctaagttcatg
gttgatcttaaaaaactgatggaaaatccatttacattattgatttga

DBGET integrated database retrieval system