KEGG   Streptococcus mutans UA159-FR: SMUFR_0544Help
Entry
SMUFR_0544        CDS       T03797                                 

Gene name
sodA
Definition
(GenBank) manganese-type superoxide dismutase
  KO
K04564  superoxide dismutase, Fe-Mn family [EC:1.15.1.1]
Organism
smua  Streptococcus mutans UA159-FR
Brite
Enzymes [BR:smua01000]
 1. Oxidoreductases
  1.15  Acting on superoxide as acceptor
   1.15.1  Acting on superoxide as acceptor (only sub-subclass identified to date)
    1.15.1.1  superoxide dismutase
     SMUFR_0544 (sodA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Sod_Fe_C Sod_Fe_N
Motif
Other DBs
NCBI-ProteinID: AJD55017
LinkDB All DBs
Structure
PDB: 

Position
588121..588762
Genome map
AA seq 213 aa AA seqDB search
MYQKKKRGNDMAILLPDLPYAYDALEPYIDAETMTLHHDKHHATYVANANAALEKHPEIG
ENLEVLLADVEQIPADIRQSLINNGGGHLNHALFWELLSPEKTKVTAEVAAAINEAFGSF
DDFKAAFTAAATTRFGSGWAWLVVDKEGKLEVTSTANQDTPISQGLKPILALDVWEHAYY
LNYRNVRPNYIKAFFEVINWNTVARLYAEALTK
NT seq 642 nt NT seq  +upstreamnt  +downstreamnt
atgtatcaaaaaaagaaaagaggaaatgatatggctattcttttaccagatcttccatat
gcttatgacgcacttgaaccatatattgatgctgaaacgatgacccttcatcatgataag
catcatgcaacttatgtcgcaaacgctaatgcggctcttgaaaaacatccagaaatcgga
gaaaatttggaagtgcttttggctgatgtggaacaaattccagcggatattcgtcagtct
ttgattaataatggtggcggtcatcttaatcacgctcttttctgggaactcttgtcacca
gaaaagacaaaagttactgcggaagtagccgcagcaattaatgaagcttttggctcattt
gatgattttaaagcagcttttacagctgccgcaacgacgcgttttggctcaggttgggct
tggttagtagttgataaagaaggaaaacttgaagtgacctcaacagctaatcaagatact
ccaatttcacagggcttgaaaccaattctagcacttgatgtctgggaacacgcttattat
ctcaattatcgtaatgttcgtccaaactatatcaaagccttctttgaagttatcaattgg
aacactgttgctcgtctttatgccgaagctctcactaaataa

DBGET integrated database retrieval system