KEGG   Streptococcus mutans UA159-FR: SMUFR_0620Help
Entry
SMUFR_0620        CDS       T03797                                 

Gene name
ppc
Definition
(GenBank) phosphoenolpyruvate carboxylase
  KO
K01595  phosphoenolpyruvate carboxylase [EC:4.1.1.31]
Organism
smua  Streptococcus mutans UA159-FR
Pathway
smua00620  Pyruvate metabolism
smua00680  Methane metabolism
smua01100  Metabolic pathways
smua01120  Microbial metabolism in diverse environments
smua01200  Carbon metabolism
Brite
KEGG Orthology (KO) [BR:smua00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00620 Pyruvate metabolism
    SMUFR_0620 (ppc)
  09102 Energy metabolism
   00680 Methane metabolism
    SMUFR_0620 (ppc)
Enzymes [BR:smua01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.1  Carboxy-lyases
    4.1.1.31  phosphoenolpyruvate carboxylase
     SMUFR_0620 (ppc)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PEPcase PEPcase_2
Motif
Other DBs
NCBI-ProteinID: AJD55093
LinkDB All DBs
Position
668237..670960
Genome map
AA seq 907 aa AA seqDB search
MTINKLESRNDKEAIAEEITILTKLLDDATKTMVGSASFDKITLFKKLSIEEKHQELERE
IEQLTNEEMVVVSRYFSILPLLINISEDVNLAYEINYQNNNDIDYLGKLSATIELVSSQK
NAQEILENVNVVPVLTAHPTQVQRKTMLDLTNHIHELLRKYRDVKAGSINKQKWYDDMRR
YVELIMQTDIIREKKLKVTNEITNVMEYYNSSLIKGVTKLITEYKHLSHQKGFDLGNAKP
ITMGMWIGGDRDGNPFVTAETLKISALVQNEVILNYYIDKVSDLYRTFSLSTSLSTISNA
VKEMADRSTDVSIYREKEPYRKAFHYIQSRLQETLIYLKNNHLEELESEDSAQILPYQSA
QEFRNDLQLIKDSLLENNGSAFITGDLTELLQAVDVFGFFLASIDMRQDSSVHETCVAEL
LASANIVANYSDLPEEEKIAILLKELTEDPRILSATHVEKSEILQKELAIFKTARKLKDA
LGEDVIKQHIISHTESISDMFELAIMLKEVGLVDTDKARVQIVPLFETIEDLDNSREIMR
QYLNYDIVKKWIAANHNYQEIMLGYSDSNKDGGYLSSGWALYKAQNELTEIGYDNGVKIT
FFHGRGGTVGRGGGPSYEAITSQPFGSIKDRIRLTEQGEVIGNKYGNKDVAYYNLEMLVS
ATLDRMVTRRIVNSDNLVNYRLIMDEIVADSNLIYRDLVFGNEHFYDYFFAASPIREVSS
LNIGSRPAARKTITEISGLRAIPWVFSWSQNRIMFPGWYGVGSAFKHFIDKDEKNLTKLQ
EMYQSWPFFHSLLSNVDMVLSKSNMNIAFEYAKLCQDEETKEVFATILDEWQLTKNVILA
IESHKQLLEDNSYLKASLDYRLPYFNVLNYIQIELIKRQRRGELGENLENLIHITINGVA
TGLRNSG
NT seq 2724 nt NT seq  +upstreamnt  +downstreamnt
gtgacaatcaacaaactagaaagtagaaatgataaagaagcaattgctgaggagattact
attcttaccaaactactggacgatgctaccaaaacaatggttggcagtgctagctttgat
aagattaccctctttaaaaaattatcaattgaagagaagcatcaagagttagaacgtgaa
attgagcagttaacaaatgaagaaatggtcgttgtttctcgttatttctccattttaccg
cttcttatcaatatttctgaagatgtcaatttagcttatgaaatcaactatcaaaacaat
aatgatattgattatttagggaaattatcagccactattgaacttgtttctagtcaaaaa
aatgctcaagaaattctggaaaatgttaatgttgtccctgttctaacagcgcatccaact
caagtgcagcgaaaaacgatgctggatttaactaatcatattcatgaacttttgcgtaag
taccgtgatgttaaagctggatctattaacaagcaaaaatggtatgacgatatgcgccgt
tatgttgagctcattatgcaaacagatattattcgtgaaaagaaattaaaagtcactaat
gaaattactaatgtcatggaatactataattcctctctgattaagggtgttactaaatta
attacagaatacaagcacttgtctcatcaaaaaggatttgatttaggaaatgctaaacca
attacgatgggaatgtggattggcggtgaccgtgatgggaatcctttcgtcactgctgaa
accctgaaaatatcagctctggtgcaaaatgaagtgattttaaattattatattgacaaa
gtttcagatctttatcgaacattttctctttcaaccagcctttctactattagcaatgca
gttaaagagatggcagatcgttcaacggatgtttcgatttaccgagaaaaagaaccctat
cgtaaggcttttcattatattcaatcaagattgcaagagactcttatttatttaaaaaac
aaccatttagaagagttggagtctgaagatagtgctcaaatccttccttatcaatcagcg
caagagtttagaaatgatttgcaactcatcaaagattctcttttagaaaataacggttct
gcttttattacgggtgatttaacagaattattgcaggcagttgatgtttttggtttcttt
ttagcttctattgatatgcgacaagattccagtgttcacgaaacctgtgtagcagaactg
ttagcttcagccaatattgttgctaactatagcgacttacctgaagaagaaaagattgct
attcttctcaaagaattgactgaagatcctcgaatactgtctgcaacgcatgttgaaaaa
tcggaaatattgcaaaaggaattagctatttttaaaacagctaggaaattgaaggatgct
ctgggagaagatgtgattaaacaacatatcatttcacacacagaaagcatttctgatatg
tttgaattagctatcatgctcaaagaagttggcttggttgatacagataaggcgcgtgtg
caaattgttcctttatttgaaaccattgaggacttggataattctcgcgaaatcatgaga
cagtatctcaattatgatattgttaaaaaatggattgcagccaatcataattatcaggaa
attatgctgggttactcagattctaacaaggatggtggttatttatcgtctggctgggcg
ctctacaaagcacaaaatgaattgacagaaattggttatgataatggtgttaaaatcacc
tttttccatggacgcggcggtactgttggacgtggtggcggtccatcttatgaggctatt
acatcacagccatttggttccatcaaggatcggattcgtttaacagaacagggtgaggtt
attggtaataaatatggcaataaggatgttgcatactacaacctggaaatgctggtttca
gcaactcttgatcgcatggtgacaagaaggattgtcaattcagataacttagtcaattat
cgtttaatcatggatgaaattgttgctgacagtaatctcatttatcgtgatttagttttc
ggaaacgaacatttctatgattatttcttcgcagctagtccaattcgcgaagtttcaagt
ttgaatattggttcccgtccagcagctcgtaagacgattacagagatcagcggtttgcgc
gctattccttgggtattctcatggtctcaaaatcgcatcatgtttccaggatggtacggt
gttggttcagcatttaaacattttatagataaggatgaaaagaatttgactaaattgcag
gaaatgtatcaatcatggcctttcttccattcattgttgtcaaatgttgacatggtttta
tccaaatcaaatatgaatattgcctttgaatatgctaaattatgtcaggatgaagaaaca
aaagaagtctttgcaactattttggatgaatggcaattaaccaaaaatgttattctagca
attgaaagtcacaaacagcttttagaagataatagttatttgaaagctagtcttgattat
cgtttaccttactttaatgttttaaattatattcaaattgagttaattaaacgtcagcgc
cgtggtgaattaggtgagaatttagagaacctgattcacattactattaatggtgtcgca
actggtttacgaaattcaggttaa

DBGET integrated database retrieval system