KEGG   Streptococcus mutans UA159-FR: SMUFR_1063Help
Entry
SMUFR_1063        CDS       T03797                                 

Definition
(GenBank) uracil-DNA glycosylase
  KO
K03648  uracil-DNA glycosylase [EC:3.2.2.27]
Organism
smua  Streptococcus mutans UA159-FR
Pathway
smua03410  Base excision repair
Brite
KEGG Orthology (KO) [BR:smua00001]
 09120 Genetic Information Processing
  09124 Replication and repair
   03410 Base excision repair
    SMUFR_1063
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03400 DNA repair and recombination proteins [BR:smua03400]
    SMUFR_1063
Enzymes [BR:smua01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.2  Hydrolysing N-glycosyl compounds
    3.2.2.27  uracil-DNA glycosylase
     SMUFR_1063
DNA repair and recombination proteins [BR:smua03400]
 Eukaryotic type
  SSBR (single strand breaks repair)
   BER (base exicision repair)
    DNA glycosylases
     SMUFR_1063
 Prokaryotic type
     SMUFR_1063
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: UDG
Motif
Other DBs
NCBI-ProteinID: AJD55534
LinkDB All DBs
Position
complement(1157447..1158100)
Genome map
AA seq 217 aa AA seqDB search
MEHSAWHDLIKKELPEGYFAQINHFMNEVYAQGVIYPPRDKVFNAIQTTPLDKVKVVIIG
QDPYHGPNQAQGLSFSVPDQVPAPPSLQNILKELADDIGQKQSHDLTSWAKQGVLLLNAS
LTVPEHQANAHANGIWEPFTDAVIKVVNQKETPVVFILWGGFARKKKALITNSIHHIIES
PHPSPLSAHRGFFGSKPFSQTNHFLVAQGLEPIDWLK
NT seq 654 nt NT seq  +upstreamnt  +downstreamnt
atggaacattcagcttggcatgatttgattaagaaagaacttccagaaggctattttgct
cagattaatcattttatgaatgaagtgtatgcgcaaggtgttatttatccacctagagat
aaggtctttaatgccattcagaccacacctttggataaggttaaggttgttattattggt
caggatccttatcacggacccaatcaggcacagggattatctttttctgtacctgatcaa
gtgcctgctccgccatctctccaaaatattttaaaggaactggcagatgatattggacaa
aaacaaagtcatgatttgacctcttgggccaagcaaggtgtgcttttgttaaatgctagc
ttaacggttcctgaacatcaggctaatgctcatgccaatggtatctgggaaccttttacg
gatgccgttattaaggttgttaatcaaaaagagacaccggttgtctttattctttggggt
ggttttgcacgtaagaaaaaggcacttattaccaattccattcaccatattattgaatcg
ccccatcctagccccttgtctgctcaccgaggattttttggcagtaaacctttctcacag
acaaatcattttttagtggcacaaggtttagaacccattgattggcttaaataa

DBGET integrated database retrieval system