KEGG   Streptococcus mutans UA159-FR: SMUFR_1228Help
Entry
SMUFR_1228        CDS       T03797                                 

Definition
(GenBank) phosphatase
  KO
K01101  4-nitrophenyl phosphatase [EC:3.1.3.41]
Organism
smua  Streptococcus mutans UA159-FR
Pathway
smua00627  Aminobenzoate degradation
smua01120  Microbial metabolism in diverse environments
Brite
KEGG Orthology (KO) [BR:smua00001]
 09100 Metabolism
  09111 Xenobiotics biodegradation and metabolism
   00627 Aminobenzoate degradation
    SMUFR_1228
Enzymes [BR:smua01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.3  Phosphoric-monoester hydrolases
    3.1.3.41  4-nitrophenylphosphatase
     SMUFR_1228
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Hydrolase_6 Hydrolase_like Hydrolase HAD_2 Hydrolase_3
Motif
Other DBs
NCBI-ProteinID: AJD55699
LinkDB All DBs
Structure
PDB: 

Position
complement(1344788..1345561)
Genome map
AA seq 257 aa AA seqDB search
MTYKGYLIDLDGTIYKGKDRIPAGEDFVKRLQERQLPYILVTNNTTRTPEMVQEMLATSF
NIKTPLETIYTATLATIDYMNDMKRGKTAYVIGETGLKKAVAEAGYREDSENPAYVVVGL
DTNLTYEKLTLATLAIQKGAVFIGTNPDLNIPTERGLLPGAGAILFLLEKATRVKPIIIG
KPEAVIMNKALDRLGVKRHEAIMVGDNYLTDITAGIKNDIATLLVTTGFTKPEEVPALPI
QPDFVLSSLAEWDFDER
NT seq 774 nt NT seq  +upstreamnt  +downstreamnt
atgacatacaagggttatcttattgaccttgatgggaccatctataaaggaaaagacaga
attcctgctggagaagattttgttaaacgattgcaggaaagacagcttccctatatttta
gtgactaataatacaacacgtacgcccgaaatggttcaagaaatgctagcaacctctttt
aatatcaaaacgccacttgaaactatttacacagcgacattagcgactattgattatatg
aacgatatgaaacgtgggaaaacagcttatgtcattggtgaaacaggacttaaaaaggct
gttgctgaagcggggtatcgtgaagatagtgagaatcctgcttatgtagtggttggttta
gatacgaatttgacttatgaaaagctaactctggcaactttggccattcaaaaaggagct
gtttttattggaacaaatcctgatcttaatattccaacagagcgcggcttattgccggga
gcgggggctattttatttcttttggaaaaagcaacacgtgtcaagcctattattattggt
aagcctgaagctgttatcatgaataaagctttagatcgtctgggcgtcaaacgccatgaa
gcgataatggttggcgataattatctgacagatattactgctggcattaaaaatgatatt
gcaacgcttttggtgacgacaggtttcaccaaaccagaagaagtacctgctttgccaatt
cagcctgattttgttttatccagtcttgcggagtgggatttcgatgaaagataa

DBGET integrated database retrieval system