KEGG   Sulfurospirillum multivorans: SMUL_0529Help
Entry
SMUL_0529         CDS       T03049                                 

Gene name
sodB
Definition
(GenBank) superoxide dismutase [Fe]
  KO
K04564  superoxide dismutase, Fe-Mn family [EC:1.15.1.1]
Organism
smul  Sulfurospirillum multivorans
Brite
Enzymes [BR:smul01000]
 1. Oxidoreductases
  1.15  Acting on superoxide as acceptor
   1.15.1  Acting on superoxide as acceptor (only sub-subclass identified to date)
    1.15.1.1  superoxide dismutase
     SMUL_0529 (sodB)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Sod_Fe_C Sod_Fe_N
Motif
Other DBs
NCBI-ProteinID: AHJ11804
UniProt: W6EB64
LinkDB All DBs
Position
509197..509793
Genome map
AA seq 198 aa AA seqDB search
MAITLPALPYEANALEPHISANTLGFHHGKHHQTYVTNLNNLIQGTELAEESLEKIILAV
ANKPEKMGIFNNAAQVWNHTFYWNCMKKGGGGAPSGAIATKITEDFGSFDTFVEAFKSAG
LTQFGSGWAWLVLEGGKLKITKTANADTPLAHDQKAILTVDVWEHAYYLDYQNKRADYLD
VFLKSLVNWDFANANLKA
NT seq 597 nt NT seq  +upstreamnt  +downstreamnt
atggctattactttaccggcacttccttacgaagctaacgcactagaacctcacatctca
gccaatacccttggatttcatcatggaaagcatcatcaaacttatgttaccaatctgaac
aatcttatccaaggcactgaacttgccgaggagagtcttgaaaagatcattttagcggtt
gccaataaacctgaaaaaatgggtatttttaacaatgctgctcaagtttggaaccatacg
ttttactggaactgtatgaaaaaaggcggcggtggcgctccaagtggcgcgattgcgact
aaaatcaccgaagattttggaagttttgacacgtttgtcgaagcgtttaaaagcgcagga
ctcacacaatttggtagcggttgggcatggcttgtacttgaaggtggaaaactgaaaatc
accaaaactgccaatgctgacacacctctcgcacacgatcaaaaagcgattttaaccgtc
gatgtttgggagcatgcgtattatctggattatcaaaacaaacgtgctgattatttggat
gttttcttgaaaagtcttgtcaattgggattttgctaacgcaaatttaaaagcataa

DBGET integrated database retrieval system