KEGG   Sulfurospirillum multivorans: SMUL_2303Help
Entry
SMUL_2303         CDS       T03049                                 

Definition
(GenBank) putative peptidoglycan glycosyltransferase
  KO
K05366  penicillin-binding protein 1A [EC:2.4.1.129 3.4.16.4]
Organism
smul  Sulfurospirillum multivorans
Pathway
smul00550  Peptidoglycan biosynthesis
smul01100  Metabolic pathways
smul01501  beta-Lactam resistance
Brite
KEGG Orthology (KO) [BR:smul00001]
 09100 Metabolism
  09107 Glycan biosynthesis and metabolism
   00550 Peptidoglycan biosynthesis
    SMUL_2303
 09160 Human Diseases
  09175 Drug resistance: antimicrobial
   01501 beta-Lactam resistance
    SMUL_2303
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01003 Glycosyltransferases [BR:smul01003]
    SMUL_2303
   01011 Peptidoglycan biosynthesis and degradation proteins [BR:smul01011]
    SMUL_2303
Enzymes [BR:smul01000]
 2. Transferases
  2.4  Glycosyltransferases
   2.4.1  Hexosyltransferases
    2.4.1.129  peptidoglycan glycosyltransferase
     SMUL_2303
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.16  Serine-type carboxypeptidases
    3.4.16.4  serine-type D-Ala-D-Ala carboxypeptidase
     SMUL_2303
Glycosyltransferases [BR:smul01003]
 Polysaccharide
  Bacterial polysaccharide
   SMUL_2303
Peptidoglycan biosynthesis and degradation proteins [BR:smul01011]
 Peptidoglycan biosynthesis and degradation
  Glycosyltransferase/DD-Transpeptidase (Class A PBP)
   SMUL_2303
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Transgly Transpeptidase Spore_II_R Beta-lactamase2
Motif
Other DBs
NCBI-ProteinID: AHJ13556
UniProt: W6ESV9
LinkDB All DBs
Position
complement(2212399..2214324)
Genome map
AA seq 641 aa AA seqDB search
MKYIITILTMLGFAAVMAIIFLYAQIRFDADKIIDYNPKLTTQIYDRNGDLVANLFDDEN
RIYVEYKDIPSRVIEALVATEDTSFFEHNGINIEAIFRALIKDIHAMKLVEGASTITQQL
IKNTVLTRQKTLTRKINEAILAYTVEAALTKEQILERYFNHVYFGHGYYGIKTASLGYFK
KPLEGLSLKEIAMLVGLPKAPSSYDPTRHMDLSLSRANQVLSRLYTLGWISEAEYTKATL
EHPMVYDETLTRNRAPYVVDEVIKSLASEYDDIKKGGYKIYLTIDLKMQQLAHDALNVGY
KGMVARMGKDANATELNGAMVVMENNTGNVLALVGGIDYAKSSFNRATQSKRQPGSSFKP
FLYQKALDWGYSPLSEIPDISRTYVNSETDEEWKPKNYENDFEGLITLKEALVHSRNLAT
INLLSLLGMDSVYKELKKDGFKNIAMDLTLALGSFGISPLEYSSFYSMFPNYGVKVEPLL
VKKVITRQGVEKVYETESQILTSPKQSYLMIDMLKEVVKRGTGRNAQVPGIEIGGKTGTT
NSSVDVWFCGFSPDIEVITWYGNDNNTPLKKGETGGRSAAPAFKYFMTKYVELHPETTRE
FKMPEGVNARKVDGTTEFFTDVSPFPKSSTKELNEEGGLMF
NT seq 1926 nt NT seq  +upstreamnt  +downstreamnt
gtgaaatacattataacaattttaaccatgcttggatttgcagcggttatggccattatc
tttttatacgcacagattcggtttgatgccgataaaattattgactataacccaaaatta
accacacaaatttacgatcgcaacggtgatcttgttgctaatctttttgatgatgaaaat
aggatctatgttgagtacaaagatattccttcacgtgttattgaagcgttggttgcaacc
gaagatacctcattttttgagcacaatggtattaatattgaagcgatttttagagcgctg
attaaagatattcatgccatgaaactggttgagggggcaagtacgatcactcaacagctc
atcaaaaataccgttttgacacgccaaaaaaccttgacccgtaaaatcaacgaagcgatt
cttgcctacacggttgaagccgcattgaccaaagagcagattttagagcgttactttaat
catgtctattttgggcatggttattacgggattaaaaccgcgtctcttgggtattttaaa
aaaccacttgaaggactgagtcttaaagagattgccatgttagtcggacttcctaaggca
cctagttcgtatgacccaacgcgccatatggatctctccctaagcagggccaatcaagtt
ctcagccgtctttataccctcggctggatcagtgaggcggaatacactaaagcaaccttg
gagcatccaatggtgtatgacgaaaccttaacacgcaatcgtgccccttatgtggtggat
gaagtgattaaaagcttagcctcagagtacgacgatatcaaaaaaggtgggtataaaatt
taccttacgattgatcttaagatgcaacaacttgctcatgacgcccttaatgtagggtat
aaaggaatggttgctcgtatgggaaaagatgccaatgcaacagagctcaatggtgcgatg
gtggttatggaaaacaacacgggcaatgttttagcgcttgtgggtggcattgattatgca
aaaagcagttttaatcgtgcaacacagagcaaacgccaaccaggatcaagttttaagcct
ttcttgtaccaaaaagctttggattggggttattcaccactgtctgaaattcctgatatt
tcacgaacctatgtcaacagtgaaaccgatgaagagtggaaaccaaaaaactatgaaaat
gattttgaaggtttgatcacacttaaagaggcgttggtgcattcgcgtaaccttgctacg
atcaatcttttatcgcttttaggaatggacagtgtctataaagagctaaaaaaagatggt
tttaaaaatattgctatggatttaacactcgcccttggaagctttggtatttcaccgctt
gaatacagtagtttttactccatgttccctaattatggtgtgaaagtcgaaccgcttctt
gtcaagaaagtgatcacgcgtcaaggagttgaaaaagtgtatgaaacagagagtcaaatc
cttacttctcccaagcagagctacttgatgattgatatgctcaaagaggttgtgaaacga
ggaacaggacgaaatgcgcaagttccgggcatcgaaattggaggaaaaacaggaacaacc
aatagcagtgtggatgtctggttttgtggtttttcaccggatattgaagtgattacctgg
tatggcaatgacaacaataccccgcttaaaaaaggcgaaacgggtggtcgttctgcggca
cctgcgtttaaatactttatgacaaagtatgttgaactgcatcctgaaaccacacgtgaa
tttaagatgccagaaggtgtcaatgcccgaaaggttgatggaaccacagagttttttacc
gatgtctcaccgtttccaaagagcagcaccaaagagttaaacgaagagggtggtttgatg
ttctaa

DBGET integrated database retrieval system