KEGG   Sulfurospirillum multivorans: SMUL_2393Help
Entry
SMUL_2393         CDS       T03049                                 

Definition
(GenBank) putative bacterial beta-(1,6)-glucosyltransferase
Organism
smul  Sulfurospirillum multivorans
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Glyco_tranf_2_3 Glyco_trans_2_3 Glycos_transf_2 Glyco_transf_21 Glyco_hydro_17 Chitin_synth_2
Motif
Other DBs
NCBI-ProteinID: AHJ13639
UniProt: W6EGA9
LinkDB All DBs
Position
2307179..2309713
Genome map
AA seq 844 aa AA seqDB search
MKYFKYILLSLVVTSLIQILFWTRAGDKIVTSPQIGEKLESLSYTPYRGFEKAPKSDREI
AEDMKTIEHIARKVRTYAIDDAKRVLENVKDTKLKVDVGLWLSGDKGANESEIETLFELT
KYYSPKIASIIVGNEVLLRADLTPEELMEYIDRVSKRTRIPVTTAEVQHVWLTNKELARH
VDFINVHILPYWEKIPIERTLAFAKEKYDSIAAMYPKKPITIGEFGWPSSGYNNEKAEAT
LTNQIAAITGFLEMANAEKWSYNIVEAFDQPWKGVHEGSVGPYWGLFDINKQPKFHFIKQ
TIINPLWRYQMAGSVFFGLLLTYFGLRNQRVNFAHAITYGFAAQAMGFGIAMAATYPFIY
YMNFGMWVMWTMGIFLMIPLVIITLAKINELFKCTLGIAPKRLAPLNLKSDHIPFVSIHV
PAYKEQPQVLIDTLNSLAQIKYTNYEVLVVINNTPEEFYWKPIEEHCQKLGEKFVFLNIT
CKGFKAGALNEALKLTHEKAEILAVIDADYVVDENWLVDLVPLFDDPKVALVQAPQDHRD
GQESLIKQAMNAEYAGFFDIGMVERNEENAIVAHGTMLMARLSAMHEVGDWTTYTIVEDS
ELGLRLFEAGYTAHYTNRRYGWGLLPDTVEAFRTQRHRWAYGAIQILKRHWRHFMPSSKT
LTPYQKYHFVAGWFFWLSDAFGALTAFLNIFWVPFIIFVGVTIPTLPLTLPILVAFLVNI
LHAFILYHTRVKMSVRETMLSAIASMSLQLVIFKAVYDGFVKDGLPFKRTEKGGNTKKVN
KSPIQHEMILATLLTISFFALYFTNYTRITEIYVFAFTLLIQSVPYYSAIILRIIELQSF
KPQK
NT seq 2535 nt NT seq  +upstreamnt  +downstreamnt
ttgaaatatttcaaatacatcctactttccctcgttgtaacatccctcattcaaatttta
ttctggacaagagctggcgataaaatcgtcacgtcaccgcaaattggtgaaaaactagag
tctctctcctacacaccctaccgtggatttgaaaaggcgcctaagagcgatcgtgaaatt
gctgaagatatgaaaaccattgagcacattgcacgcaaagtaagaacttatgcgattgat
gatgccaagcgtgttttagaaaatgtgaaagatactaaactcaaagtcgatgtcggtctt
tggctctcaggggataaaggcgcaaacgaatctgaaatcgaaacgctttttgaattgacc
aaatattacagccctaaaattgcttccatcatcgtcggaaacgaggttttgctgcgagct
gatctgacacctgaagagcttatggagtacattgatcgtgtctcaaaacgcacacgaatc
cctgtcaccacggcagaagttcaacacgtttggctcaccaacaaagagcttgcacgtcat
gttgattttattaacgttcacattttaccgtattgggagaaaattcctattgagcgaacc
cttgcgtttgccaaagagaaatacgactcgattgcggcaatgtaccctaaaaaacccatt
accatcggagagtttggctggccaagcagtggctataacaacgaaaaagcggaagccact
ctgaccaaccagatcgctgccattacaggctttttggagatggcaaacgctgagaaatgg
agctacaacatcgttgaagcgttcgatcagccgtggaaaggggttcatgaaggcagtgta
ggaccgtattggggactttttgacatcaataaacaacctaaatttcactttatcaaacag
accattatcaacccactgtggcgttaccaaatggcaggctcggtcttctttggactgctt
ctaacgtattttggtcttagaaatcagcgggttaactttgcccatgccattacgtatggt
tttgcagcgcaagcgatgggctttggtatagcgatggctgcaacgtatccgtttatctac
tacatgaactttggtatgtgggttatgtggacaatgggaattttcttgatgattcctctg
gtcatcattaccttagctaagattaatgagctctttaaatgcacccttggtattgcaccc
aaacgtcttgcaccgcttaatcttaagtcggatcatatcccctttgtctccattcatgtg
ccagcctacaaagaacaaccgcaagttttgatcgataccctcaattcactcgcgcaaata
aagtacaccaactatgaagttttggtggtgattaacaacacgcctgaagagttttactgg
aagcctatcgaagagcattgtcaaaaactcggcgaaaaatttgtctttttgaacattaca
tgtaaaggtttcaaagcaggcgcactcaatgaagcacttaaactcacccatgaaaaagca
gagattttagctgttattgatgcagattatgtggtcgatgaaaactggctcgttgacctt
gttccactctttgatgatccaaaagtggctcttgttcaagcaccacaagatcaccgtgat
ggacaagaatcgctcattaaacaggcgatgaacgctgaatatgcaggcttttttgacatc
ggtatggttgagcgaaatgaagaaaatgccatcgtagcacacggaacgatgctgatggct
cgcttgtctgcgatgcacgaagtgggagactggacaacgtacacgatcgttgaagactct
gagctaggacttcgcctttttgaagcgggttatacggcacattacaccaaccgacgttac
ggttggggactcttacccgacaccgtggaagcgtttcgtacacaacgtcaccgttgggcg
tatggtgccattcagatcttaaaacgtcactggcgtcactttatgccttcatccaaaacg
ttaacgccgtaccaaaagtaccatttcgtcgcaggttggttcttctggctttctgatgcc
tttggagcgttgaccgcttttttaaatattttctgggtgccatttatcatttttgtcggt
gtgacgattccaacactgccactcaccttgcctatcttagtcgcatttttggtcaacatc
ttacatgcgtttatcttgtaccataccagagtcaaaatgagtgtaagagaaacaatgctg
agtgccatcgcttcgatgagtttgcaactggtgatcttcaaagcggtatacgatggattt
gttaaagatggacttccgtttaaacgcacggaaaaaggtggaaataccaaaaaagtcaat
aaaagcccaattcagcatgagatgattttagccaccctgcttaccatctctttcttcgcg
ctttattttaccaactacacacgcattaccgaaatttatgtctttgccttcacccttttg
attcagagtgtcccttattactccgcaattatccttcgtatcatcgaacttcaatccttt
aaacctcaaaagtag

DBGET integrated database retrieval system