KEGG   Sulfurospirillum multivorans: SMUL_2418Help
Entry
SMUL_2418         CDS       T03049                                 

Gene name
dacB
Definition
(GenBank) D-alanyl-D-alanine carboxypeptidase DacB
  KO
K07258  serine-type D-Ala-D-Ala carboxypeptidase (penicillin-binding protein 5/6) [EC:3.4.16.4]
Organism
smul  Sulfurospirillum multivorans
Pathway
smul00550  Peptidoglycan biosynthesis
smul01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:smul00001]
 09100 Metabolism
  09107 Glycan biosynthesis and metabolism
   00550 Peptidoglycan biosynthesis
    SMUL_2418 (dacB)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01002 Peptidases [BR:smul01002]
    SMUL_2418 (dacB)
   01011 Peptidoglycan biosynthesis and degradation proteins [BR:smul01011]
    SMUL_2418 (dacB)
Enzymes [BR:smul01000]
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.16  Serine-type carboxypeptidases
    3.4.16.4  serine-type D-Ala-D-Ala carboxypeptidase
     SMUL_2418 (dacB)
Peptidases [BR:smul01002]
 Serine Peptidases
  Family S11: D-Ala-D-Ala carboxypeptidase A family
   SMUL_2418 (dacB)
Peptidoglycan biosynthesis and degradation proteins [BR:smul01011]
 Peptidoglycan biosynthesis and degradation
  DD-Carboxypeptidase/DD-Endopeptidase (Low molecular weight PBP)
   SMUL_2418 (dacB)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Peptidase_S11 Beta-lactamase2 Peptidase_S13
Motif
Other DBs
NCBI-ProteinID: AHJ13664
UniProt: W6EGD9
LinkDB All DBs
Position
2329574..2330488
Genome map
AA seq 304 aa AA seqDB search
MTHKILSLICGACIITSSLSAAYLDKETADRIRRNTDSIIAKDLSTKQLIFAKDEQKINQ
PASLTKIMTALLALESGRMNEVVTITREMIQVEPTKANLRVGEKFYLRDLVKAAMVMSAN
DAAMSIGVFLGDGDVDKFVVQMNKKAKAIGMKNTNFTNPCGFDIGRHYSTALDLLTMSEY
AIKNNNFNEMAKLKRHDFRAINTKRSYAAYTHNKLLNNYKYAVGIKTGYTQKAGPCLIAR
AKNGKKDILVVMLNSEHRWNDIRTIFEDVLPDITHSKVASQKATAPSKSKKKTTASKKKA
QKIA
NT seq 915 nt NT seq  +upstreamnt  +downstreamnt
atgacacacaaaattttatcgcttatctgcggcgcatgcattatcacaagctcccttagt
gcagcttaccttgacaaagagaccgcggatcgtattagacgcaacaccgattcgatcatt
gcaaaagacttaagtacaaaacaacttatcttcgccaaagatgaacaaaaaatcaaccaa
cccgcaagtttaaccaaaattatgaccgccctgttagccctagagagtggtcgtatgaac
gaggttgtaacgattacccgtgaaatgatccaagttgaacccactaaagcaaaccttcgt
gtgggtgaaaaattctacttaagagaccttgttaaagcggcaatggtcatgtctgctaat
gatgctgcgatgagcattggcgtctttttgggggatggggatgtcgataaatttgtagta
caaatgaataaaaaagccaaagccattggcatgaaaaataccaacttcaccaacccatgc
ggatttgacattggtcgtcactactccaccgcactggatcttttaacgatgagtgaatat
gcaattaaaaacaacaattttaacgagatggcaaaactaaagcgtcacgattttagagcg
atcaataccaaaagatcgtatgccgcctacacccataataaactgctcaacaactacaaa
tacgccgtcggaatcaaaacaggctacacccaaaaagcaggcccatgtctcattgcgcgt
gctaaaaatgggaaaaaagatatcttagtggtgatgctcaactccgaacaccgttggaat
gacattagaaccatttttgaagatgttctacctgacatcacccactctaaagtagcctct
caaaaagcaactgcgccatcaaaaagcaaaaagaaaaccaccgcaagcaagaaaaaagca
caaaaaatcgcgtag

DBGET integrated database retrieval system