KEGG   Simonsiella muelleri: BWP33_01175Help
Entry
BWP33_01175       CDS       T05344                                 

Definition
(GenBank) D-alanine--D-alanine ligase
  KO
K01921  D-alanine-D-alanine ligase [EC:6.3.2.4]
Organism
smur  Simonsiella muelleri
Pathway
smur00473  D-Alanine metabolism
smur00550  Peptidoglycan biosynthesis
smur01100  Metabolic pathways
smur01502  Vancomycin resistance
Brite
KEGG Orthology (KO) [BR:smur00001]
 09100 Metabolism
  09106 Metabolism of other amino acids
   00473 D-Alanine metabolism
    BWP33_01175
  09107 Glycan biosynthesis and metabolism
   00550 Peptidoglycan biosynthesis
    BWP33_01175
 09160 Human Diseases
  09175 Drug resistance: antimicrobial
   01502 Vancomycin resistance
    BWP33_01175
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01011 Peptidoglycan biosynthesis and degradation proteins [BR:smur01011]
    BWP33_01175
Enzymes [BR:smur01000]
 6. Ligases
  6.3  Forming carbon-nitrogen bonds
   6.3.2  Acid-D-amino-acid ligases (peptide synthases)
    6.3.2.4  D-alanine---D-alanine ligase
     BWP33_01175
Peptidoglycan biosynthesis and degradation proteins [BR:smur01011]
 Precursor biosynthesis
  Amino acid ligase
   BWP33_01175
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Dala_Dala_lig_C Dala_Dala_lig_N ATP-grasp_4 CPSase_L_D2 ATP-grasp ATPgrasp_YheCD Ntox33
Motif
Other DBs
NCBI-ProteinID: AUX60580
UniProt: V9H9M8
LinkDB All DBs
Position
complement(246772..247692)
Genome map
AA seq 306 aa AA seqDB search
MQDFGKVAVLMGGFSSEREVSLDSGNAILTALKSKGVDAHAFDPAETELFELKNQGFDIA
FNTLHGSYGEDGTVQGALEALAIPYTGCGVLASAIGMDKYRSKLLWQALNLPVPPFVILT
DTSDFTAVEAQLGLPMFIKPAAEGSSVGVYKIKTVGELQQKYQELRDQHMHGEIMAEKFM
SGGEYTCGVIYRKAFPSIKIIPQNEFYDYEAKYNRDDTIYLCPSDLIPADEQLMRDLALK
AFEAIGGGNNCGRVDFLRDADGKIYILEANTLPGMTSHSLIPKSAQVAGVAFADLCIDIL
KTAYEV
NT seq 921 nt NT seq  +upstreamnt  +downstreamnt
atgcaagattttggtaaagtagctgtgttaatgggcggattttcatcagaacgcgaagtc
tcactagacagcggtaacgccattttaaccgcactcaaaagcaaaggcgttgacgcccac
gcttttgacccagcagaaacagaattatttgaattaaaaaatcaaggttttgatattgca
ttcaatacattgcatggcagttatggcgaagatggcacagtacaaggcgcactggaagca
ttggcaattccttacacaggttgtggcgtgttagcatcagcaattggcatggataaatat
cgcagcaaattattgtggcaagctttaaatttacctgtaccgcctttcgtgattctgacc
gacaccagcgactttactgccgtagaagcacaattgggcttgcccatgtttatcaaaccc
gcagcagaaggtagcagtgttggcgtatacaaaattaaaactgttggtgaattacaacaa
aaataccaagaattacgcgaccaacatatgcacggtgaaatcatggctgaaaaatttatg
tcaggtggcgaatacacttgtggcgtgatttatcgcaaagcattccccagtatcaaaatt
attccgcaaaatgaattctatgattatgaagcaaaatataatcgtgatgatacaatctat
ctatgcccatcggatttaatcccagccgatgaacaattaatgcgtgatttggcgttaaaa
gcctttgaagccattggtgggggcaacaattgtggacgcgtggattttttacgcgatgca
gacggaaaaatttatattttagaagcaaatacattacctggtatgaccagtcatagcttg
attccaaaatccgctcaagtggcaggcgtggcatttgctgatttgtgtattgacatttta
aagacagcttatgaagtataa

DBGET integrated database retrieval system