KEGG   Simonsiella muelleri: BWP33_06055Help
Entry
BWP33_06055       CDS       T05344                                 

Definition
(GenBank) penicillin-binding protein 2
  KO
K05515  penicillin-binding protein 2 [EC:3.4.16.4]
Organism
smur  Simonsiella muelleri
Pathway
smur00550  Peptidoglycan biosynthesis
smur01501  beta-Lactam resistance
Brite
KEGG Orthology (KO) [BR:smur00001]
 09100 Metabolism
  09107 Glycan biosynthesis and metabolism
   00550 Peptidoglycan biosynthesis
    BWP33_06055
 09160 Human Diseases
  09175 Drug resistance: antimicrobial
   01501 beta-Lactam resistance
    BWP33_06055
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01011 Peptidoglycan biosynthesis and degradation proteins [BR:smur01011]
    BWP33_06055
Enzymes [BR:smur01000]
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.16  Serine-type carboxypeptidases
    3.4.16.4  serine-type D-Ala-D-Ala carboxypeptidase
     BWP33_06055
Peptidoglycan biosynthesis and degradation proteins [BR:smur01011]
 Peptidoglycan biosynthesis and degradation
  DD-Transpeptidase (Class B PBP)
   BWP33_06055
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Transpeptidase PBP_dimer Fzo_mitofusin
Motif
Other DBs
NCBI-ProteinID: AUX61413
UniProt: V9HLG9
LinkDB All DBs
Position
1254879..1256936
Genome map
AA seq 685 aa AA seqDB search
MKEIWKAPREMVDSYRTVRLLQLDFNRRLLAAFVFIVLLFCLLIARFTYLQVIKRDEYVL
KATTNRITLIPTPPIRGEIVDINGVVLAHNYPAYSLELIPSKIEGKLSDTIAALRQYVDI
SETDLNRFNKFRAEYRSYEKIPLKLRLAPDEASRLAAQLYRFQGVEINARTFREYPYGAL
TSHFLGYIGRISDHDEEKLNETNRANEYRGTTHIGKTGLEAFYEEQLHGSPGYQEVEKDA
AGNIIRVIQSEAPQTGQTLRLAMDIRLQQEADRLMAGKRGAMVAINPQTGGILAFVSKPN
FDPNLFIDGIDGETWNKLNNDWQRPLINRVTQGLYPPGSTFKPFMGMALLESGRITQNSV
VSAPGAWSIPGTSHLFRDSVRRGHGAVNLMKAIQVSSDTFFYKLGYDLGIEKAYPSLKQF
GLGQKTGVDLPNEYRGVLPSPEWKEKRFSKMKEKYRQWNPAEMVPISIGQGYNTYTPLQM
ANATAMLANNGTVYRPHLVKELLDHEKQTITVIDPKPERELPFKQTNFDYLKKAMWRVVT
GGTAHRISGGLRYSMAGKTGTAQVVQIAQGKTYNAAALREQHRDHAWFIAFAPVEKPQIA
IAVILENAGWGAKAAPLARALSDFYLLRVVPNRLDDEVKGARLTANPLLAGAQSDKAYTI
ESPYTKLAKQNRQPENNQDKKDYEK
NT seq 2058 nt NT seq  +upstreamnt  +downstreamnt
atgaaagaaatttggaaagctcctcgcgagatggtggacagttatcgtactgttcgccta
ttgcaacttgattttaaccgccgattattggcggcgtttgtctttattgtgttgctattt
tgtttattgattgcgcggtttacttatttacaagtgattaaacgtgatgaatatgttctg
aaagccaccaccaaccgcattacattgattccaactccgcccatccgtggcgaaattgtg
gatattaacggtgttgtgttggcgcataattatccagcttattcattggaactgattccg
agcaaaattgaaggcaaactaagcgatacgattgctgcattgcgtcaatatgtggacatc
agcgaaaccgacttgaatcggttcaataaatttcgtgccgaataccgttcatatgaaaaa
atcccactcaaattgcgacttgcacctgatgaagcatcgcgtttggctgcacaactgtat
cgttttcaaggtgtggaaatcaatgcaagaacatttcgtgaatatccatacggtgcattg
acttcgcattttttgggttacattgggcgaatcagtgaccatgatgaagaaaaattaaat
gaaaccaatcgtgccaatgaatatcgtggtacaacccatattggtaagacaggattagaa
gctttttatgaagaacaattgcatggttcaccaggttatcaagaagtagaaaaagatgcg
gctggtaatattattcgagtgattcagtcagaagctccacaaacagggcaaactttgcgt
ttggcaatggacattcgtttgcaacaagaagcagaccgtttgatggcgggtaaacgtggt
gcgatggtggcgattaatccacaaacggggggtattttggcgtttgtttccaaaccgaat
tttgacccgaatttatttattgacgggattgatggcgaaacgtggaataaattaaataat
gactggcaacgtccattaattaaccgcgttacgcaaggtttgtatcccccaggttctaca
tttaagccatttatgggcatggcattgctggaaagtggcagaatcacgcaaaattcggtg
gtgtctgctcctggtgcttggagtattccaggtacttcgcatttgttccgtgattcggta
agaagagggcatggcgcagttaatttgatgaaagccattcaagtttcgtcagatacgttt
ttctataaattaggctacgatttgggcattgaaaaagcctatccgtctttgaaacaattt
ggtttgggacaaaaaacaggtgtggatttacctaatgaataccgtggcgtattgcctagc
cctgagtggaaagaaaaacgtttttccaaaatgaaagaaaaatatcgccaatggaatcct
gctgaaatggtacccatcagcattgggcaaggttataacacctacacacctttgcaaatg
gcaaatgccacagcaatgctggcaaataatggcacggtgtatcgtccgcatttggttaaa
gaattacttgaccatgaaaaacaaaccattaccgttattgaccccaaaccagaacgcgaa
ttaccattcaaacaaaccaattttgattatttgaaaaaagccatgtggcgtgtggttaca
ggtggtacagcacacagaatttcaggtggtttacgctacagcatggcaggtaaaacaggt
acagcgcaagtggtgcaaatcgctcaaggtaaaacctataatgctgccgcattgcgtgaa
caacatcgagaccatgcgtggtttattgcgtttgcgcctgtggaaaaaccacaaattgcc
attgctgtgattttggaaaacgcaggttggggcgcaaaagccgcaccattggcacgcgca
ttgagtgatttttatctgttacgtgttgtgccaaatcgcttggacgatgaagtaaaaggc
gcacgtttaaccgctaatcctttattggcaggcgcgcaatccgataaagcgtacaccatt
gaatcaccttataccaaattagccaaacaaaataggcagcctgaaaataatcaagacaaa
aaagattatgaaaaataa

DBGET integrated database retrieval system