KEGG   Simonsiella muelleri: BWP33_06515Help
Entry
BWP33_06515       CDS       T05344                                 

Definition
(GenBank) uracil-DNA glycosylase
  KO
K03648  uracil-DNA glycosylase [EC:3.2.2.27]
Organism
smur  Simonsiella muelleri
Pathway
smur03410  Base excision repair
Brite
KEGG Orthology (KO) [BR:smur00001]
 09120 Genetic Information Processing
  09124 Replication and repair
   03410 Base excision repair
    BWP33_06515
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03400 DNA repair and recombination proteins [BR:smur03400]
    BWP33_06515
Enzymes [BR:smur01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.2  Hydrolysing N-glycosyl compounds
    3.2.2.27  uracil-DNA glycosylase
     BWP33_06515
DNA repair and recombination proteins [BR:smur03400]
 Eukaryotic type
  SSBR (single strand breaks repair)
   BER (base exicision repair)
    DNA glycosylases
     BWP33_06515
 Prokaryotic type
     BWP33_06515
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: UDG
Motif
Other DBs
NCBI-ProteinID: AUX61491
UniProt: V9H873
LinkDB All DBs
Position
complement(1329238..1329897)
Genome map
AA seq 219 aa AA seqDB search
MKTWRQALGAEKSQPYFQNILARVQAERDAGLTIFPPAADVFNAFKLTEFADVRVVILGQ
DPYHNVGQAHGLAFSVREGVQIPPSLVNIYKELADDIAGFHTPKHGCLNHWAQQGVLLLN
TVLTVRAHQAHSHAQFGWETFTDRVISQINAHRQNVVFMLWGSHAQKKGAMIDRTKHLVL
TAPHPSPLSAYRGFFGCKHFSQANDYLKQFNYQPIDWQI
NT seq 660 nt NT seq  +upstreamnt  +downstreamnt
atgaaaacttggcgacaagccctaggtgctgaaaaatcacaaccgtattttcaaaacatt
ttggcacgagtacaagccgaacgtgatgcaggattgaccatatttccccccgccgccgat
gtattcaacgcgtttaaattgacggaatttgcggatgtgcgcgtggtaattttggggcaa
gacccatatcacaatgttgggcaagcacatggattggcgttttcggtgcgcgaaggcgta
caaattcccccatctttagtcaatatttataaagaattagctgatgatattgctggtttt
cataccccaaaacacggctgcctcaatcattgggcgcaacaaggcgtattgttactcaac
actgtgctaacggttcgcgcccatcaggcgcattctcacgcacaatttggttgggaaaca
tttaccgaccgcgtgattagccaaatcaacgcacatcggcaaaatgtggtgtttatgctg
tggggcagccacgcacagaaaaaaggagcaatgattgaccgtaccaaacatttggttttg
actgcaccacacccatcgcctttgtcggcgtatcgtggctttttcggctgcaagcatttt
tcacaagccaatgattatttaaaacaatttaattaccaaccgattgactggcaaatttaa

DBGET integrated database retrieval system