KEGG   Staphylococcus muscae: C7J88_07010Help
Entry
C7J88_07010       CDS       T06215                                 

Definition
(GenBank) alkyl hydroperoxide reductase subunit F
  KO
K03387  NADH-dependent peroxiredoxin subunit F [EC:1.8.1.-]
Organism
smus  Staphylococcus muscae
Brite
KEGG Orthology (KO) [BR:smus00001]
 09190 Not Included in Pathway or Brite
  09191 Unclassified: metabolism
   99980 Enzymes with EC numbers
    C7J88_07010
Enzymes [BR:smus01000]
 1. Oxidoreductases
  1.8  Acting on a sulfur group of donors
   1.8.1  With NAD+ or NADP+ as acceptor
    1.8.1.-  
     C7J88_07010
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Pyr_redox_2 Pyr_redox_3 Pyr_redox GIDA Thioredoxin_3 HI0933_like FAD_oxidored FAD_binding_2 Thi4 FAD_binding_3 DAO AlaDh_PNT_C NAD_binding_8 K_oxygenase Glutaredoxin Auto_anti-p27
Motif
Other DBs
NCBI-ProteinID: AVQ33937
UniProt: A0A240CAU7
LinkDB All DBs
Position
1409297..1410820
Genome map
AA seq 507 aa AA seqDB search
MLNQELKNQLAQLLDLMEGDVVFKLSTGSDESSQKMEDLVNEVSDMSSRITVEKADLKRS
PSFSVNRPGEDTGVTFAGVPLGHEFNSFVLALLQVSGRAPKEEQSVIDQIKAIDKPLNFE
TYISLTCQKCPDVVQALNLMSVLNPNITHTMIDGATFKEEAEDIMAVPSIFLNGEQFGSG
RMTVTDILSALGQGPDASEFEGKEIFDVLVVGGGPASASSAIYAARKGLRTGIVADRIGG
QVNDTQDIENLISVKKTTGTSLAVNLEEHINEYNIDVMKGVRAESVNKTDESIDLTLDNG
AVLHTKTLIVSTGARWRQLGVPGEQELANKGVAYCPHCDGPLFEDKHVAVVGGGNSGVEA
AIDLAGICKSVTLLEFGAEMRADQVLQERLNSLSNTTVITNAATKEITGDERVTGLTYED
TQSKEQQHIELDGVFVQIGLSPNTEWLGDTVNRNRMGEIEVDRLGATNVPGIFAAGDCTD
QRYKQIIISMGSGATAALSAFDYLIRN
NT seq 1524 nt NT seq  +upstreamnt  +downstreamnt
atgcttaatcaagagttaaagaatcaacttgcacaacttcttgatttgatggaaggtgac
gttgtcttcaaattaagcacaggatctgatgaatcatctcaaaaaatggaagaccttgtg
aatgaagtatcagacatgtcatcacgcattacagtagaaaaagcagacttaaaacgttca
cctagctttagtgtgaatagacccggagaggacactggcgttactttcgccggtgttcct
cttggtcatgagtttaactctttcgttttagcacttctacaagtgagtggtcgtgcacca
aaagaagagcaatctgtaatcgatcaaatcaaagcaattgataaaccattaaactttgaa
acatatatcagcttaacatgtcaaaaatgtccggatgttgttcaagcattaaacttaatg
agtgttcttaacccaaatatcacacacacgatgattgacggtgcaacattcaaagaagaa
gctgaagatattatggctgtgccatctatcttcttaaatggtgaacaattcggtagcggt
cgtatgactgtcactgatattttaagcgcacttggtcaaggccctgatgcttcagaattc
gaaggcaaagagatattcgatgtcctcgttgtcggcggtggtcctgcgagtgcaagttct
gctatttacgctgcacgtaaaggtttacgtacaggtattgttgcggatcgtatcggtggt
caagttaacgatacacaagacatcgaaaacttaatcagcgtgaagaaaacaacaggaaca
tcacttgcggttaaccttgaagaacacattaacgaatataacatcgatgtgatgaaaggg
gttcgtgctgaatctgtaaacaaaacagacgaaagcattgaccttacattagataatggt
gccgtacttcacacaaaaacattgattgtttcaacaggtgcacgttggagacaactcggt
gtaccaggtgagcaagagcttgcaaataaaggtgttgcatactgcccacactgtgacggt
ccattattcgaagacaagcatgtcgctgttgtcggcggtggtaactctggtgttgaagct
gcgattgaccttgcaggtatctgtaagagtgtgacgttacttgaattcggtgcagaaatg
cgtgccgatcaagtcttacaagagcgtttgaactctctatctaatacaacagtcatcaca
aacgctgcaacgaaagaaattactggtgatgaacgtgtcactggtttgacttacgaagat
acacaatctaaagaacaacaacatatcgaattagacggtgtcttcgttcaaatcggtctt
tctcctaatactgagtggttaggcgatacagtcaaccgcaacagaatgggtgaaatcgaa
gttgatcgtttaggtgctacgaacgtgccaggtatctttgctgccggagactgtacagat
caacgctacaagcaaattattatctctatgggatcaggtgcaacagctgcactatctgct
tttgactaccttatccgtaactaa

DBGET integrated database retrieval system